KEGG   Paenibacillus naphthalenovorans: IJ22_36930Help
Entry
IJ22_36930        CDS       T04167                                 

Definition
(GenBank) peptide ABC transporter ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    IJ22_36930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pnp02000]
    IJ22_36930
Transporters [BR:pnp02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    IJ22_36930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_16 SMC_N AAA_22 AAA_29 RsgA_GTPase ATP-synt_ab AAA_5 AAA_7 NACHT AAA_24 AAA_30 AAA TsaE DUF87 Sigma54_activat Myosin_head AAA_19 ABC_ATPase
Motif
Other DBs
NCBI-ProteinID: ALS24031
UniProt: A0A0U2MZV5
LinkDB All DBs
Position
complement(3670425..3672464)
Genome map
AA seq 679 aa AA seqDB search
MNPLLDIERLSVEFDTGRGRLQAVSDVSFSMKAGEIVCLVGESGSGKTVTSKAIMRLIDD
ENGSIAAGAIKLDGVDVAGLSRHALRSLRGKKMAMVFQEPMAAFDPVFTIGSQIVETIRR
HNRKETSSQAWHRAVELLRRVGIPEPELRMKQYPNELSGGMLQRAMIAMALSCEPELLIA
DEPTTALDVTIQAQILQLLQDLKTEYNMSILLITHDLGIAAEIADRIIVMYAGQVVEKAS
KSELFEQPHHPYTQGLLRSITTMDSDRAKRLYAIPGSIPSLADLPGGCRFHPRCPYASEQ
CVREAPALQDRGGRQSACWNVEQLIGGDSDIPAAPTAPHAEIASASLQPAAEQAKPHTDS
LFELVHVTKHYPYGRSVFSKEKKAIRAVDDVSFSIRKGETFGLVGESGSGKSTLGRVLLH
LEKPTSGTILLEGRDLALLSGARLREERKHMQMIFQDPYGSVDPRWKVGDIIGEPFSVHG
ALNAREKREAVGELLQLVGLNPAAYDRYPHEFSGGQRQRIGIARAIALRPKFVLADEPVS
ALDVSVQAQIVNLLQDLRQQLDLTLMFIGHGLNIVRYVSDRIGVMYLGKLVEIAPSEQLF
RHPAHHYTKALVSSIPVPDPRRQRTFAAIEGEIPSPASPPSGCRFRTRCPAATARCAIEQ
PLFKEVGHGHYAACHDPVI
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttactggacatagaacggctgagtgtcgaattcgatacgggccgggggagg
ctgcaggcggtcagcgacgtaagcttctcgatgaaagccggcgagatcgtatgtttggta
ggcgaatcagggagcgggaagacggtgacctccaaagccatcatgcggctgatcgatgat
gagaacgggtccattgctgcgggcgcgatcaaactggacggcgttgacgtggcggggctt
tcgcggcacgcgctccggtcgctgcgcggaaagaagatggcgatggtgttccaggagccg
atggcggcgtttgaccccgtatttacgatcgggagccagattgtcgagaccattcggcgc
cataaccggaaggaaacctctagccaggcatggcaccgagccgtggaactgctgcgccgc
gtcggcataccggagccggagctgcgaatgaagcagtatccgaacgagctttccggcggg
atgctgcaaagggcgatgatcgccatggccttaagctgcgaaccggagctgctgatcgca
gatgaaccgacgacggcgctcgatgtcacgattcaagcgcaaattctgcagctgctgcag
gatttgaaaacggaatacaacatgtcgattttgctcatcacccatgatcttggcatcgct
gcggaaatcgccgatcgcatcatcgtgatgtacgccgggcaggtggtcgagaaggcgtcg
aagtcggaattgtttgagcagcctcatcatccctatacacagggtcttctgcggtcgata
acgacgatggacagcgaccgcgcaaagcgtctgtatgcgattccgggctcgattcccagt
cttgccgacctgccaggcggatgccgcttccatccccgctgtccctatgcatcggagcag
tgtgtccgggaggcgccggctctgcaggacagaggcggcaggcaatcggcctgctggaac
gtggagcagcttattggcggcgattcggacatccctgctgcgcctacagcgccccatgcc
gaaatcgcctccgcttctctgcagccggcggccgagcaagcaaagccgcatacggattcg
ctgttcgagcttgtccatgtgacaaaacattatccctatggacgatcggtcttctcaaaa
gagaagaaagcgatccgggcggtcgatgacgtctctttctcgattcgcaagggtgaaacg
ttcggcctggtcggcgaatccggaagcgggaaatcgacgctcggcagagttcttcttcat
ctggaaaagcctacctccggaactattctgctcgagggccgggatctggctttattgtcc
ggcgcccgcttgcgggaggagcgcaagcatatgcagatgattttccaggatccgtacggt
tccgtcgacccgcgatggaaggttggggatatcatcggggagccgttctccgttcacggt
gctttaaacgccagggagaagagggaggctgtcggggaactgctgcagctcgttggtctg
aaccctgccgcttacgatcgttatccgcacgaattttccggcggacagcggcagcgtatc
ggcatcgcgagagcgattgccctgcgtccgaagttcgtgttggccgatgagccggtatcg
gcgctcgacgtttccgttcaggcgcagatcgtcaatctgctgcaggatctgcgccaacag
ttggatttaactttgatgtttatcggtcatgggctcaatatcgtccggtacgtatcggat
cggatcggcgtcatgtacttgggcaagctggttgaaattgccccaagcgagcagctgttc
cgtcatccggcgcatcattacacgaaggccctcgtatcctccattccggtaccggatccg
cgccgtcagcgcacatttgccgctatcgaaggagaaataccgtcgccggcaagcccccct
tcgggctgccgcttccgtacgcgctgtccggctgctacggcgagatgcgctatcgagcag
cccttgttcaaagaggttgggcacggccattatgcggcttgtcatgatcctgtgatataa

DBGET integrated database retrieval system