KEGG   Paenibacillus naphthalenovorans: IJ22_38190Help
Entry
IJ22_38190        CDS       T04167                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00473  D-Alanine metabolism
pnp01100  Metabolic pathways
pnp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IJ22_38190
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    IJ22_38190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pnp01011]
    IJ22_38190
Enzymes [BR:pnp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IJ22_38190
Peptidoglycan biosynthesis and degradation proteins [BR:pnp01011]
 Precursor biosynthesis
  Racemase
   IJ22_38190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4810
Motif
Other DBs
NCBI-ProteinID: ALS24152
UniProt: A0A0U2UD09
LinkDB All DBs
Position
complement(3798875..3800062)
Genome map
AA seq 395 aa AA seqDB search
MDSFYRPTRVEISLDALRHNLEEFRRVLPEHVSMMAVVKADAYGHGAVEVCREALSSGVK
YIAVAFLDEGLELRQAGITAPILVLGYTPPEGLETAWENDITLNVYTHELLDAWERLGPR
ERPLNIHIKIDSGMNRLGLTEEHEAIELIERAMRIPGLRVEGLFTHYACADETDKSYTLE
QYGRFERVVEHFHRQGIRFPWVHAGNSAAAIDTPNLTYNMVRLGISMYGLYPSEEVNQQI
IDLQPVLSIKSAVVMVKKVPPGAGVSYGAIYRTEGEETIATLPIGYADGFSRILTGKAQV
LIKGQRVPIVGRICMDQCMMNVTGLADISVEEEVVILGSQGEERITAEEHAQWLGTINYE
VICMISHRVPRVYIKEGRVSHTVNPLLRHRWERTE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtggattcgttttaccggccgacgcgggtagaaatttcgcttgatgcactgcgtcacaac
ctggaggagtttcgaagagtacttcctgagcatgtaagcatgatggctgtcgtcaaagcg
gacgcctatggccacggcgccgtagaggtttgcagggaggcgcttagcagcggtgtgaag
tatattgctgtagcttttttggacgagggccttgagctgaggcaagcgggaataacagcg
ccgatcctggtgttgggttatacgccgcctgaagggctggagacggcctgggagaacgat
attacgctaaatgtttacacgcatgagctgttggatgcttgggagcgtttggggcccagg
gagcgtccgctgaacattcatattaagattgactccggcatgaaccggctcgggttgact
gaagagcatgaagcgattgaactgattgaacgggcgatgcggatacccgggctgcgggtg
gaagggctgttcacccattatgcttgcgcagacgagacggataaaagctatacactggag
cagtacggtcgctttgaacgggtggtggagcattttcaccgtcaaggaatccggttcccc
tgggtgcatgcgggcaacagtgccgcggcgatcgatacgccgaatttgacgtataatatg
gtacggctcgggatcagcatgtacggcttgtacccttcggaggaggtcaatcagcaaatc
attgatcttcagccggtactaagcatcaaatcggccgtagtcatggtcaaaaaggtgcct
cccggcgcaggtgttagctatggcgcgatttaccggacagagggcgaagaaacaatcgct
acgctgccgatcgggtatgcggacggattctcgcgaatactgacgggcaaggcgcaggtg
ctgatcaaaggacagcgtgtgccgatcgtgggcagaatttgtatggatcaatgtatgatg
aatgtgacgggtcttgccgatatatctgtcgaagaagaagtcgtcattctgggaagtcag
ggagaagagcgaattacggcggaggagcatgctcagtggcttggaaccatcaattacgaa
gtcatctgcatgatctcgcaccgcgttccgcgagtttatatcaaagaggggcgcgtctcg
catacggtcaatccgctgctccggcataggtgggagcggacagagtaa

DBGET integrated database retrieval system