KEGG   Paenibacillus naphthalenovorans: IJ22_47830Help
Entry
IJ22_47830        CDS       T04167                                 

Definition
(GenBank) histidine kinase
Organism
pnp  Paenibacillus naphthalenovorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase 7TMR-DISM_7TM HisKA HATPase_c_2 HATPase_c_5 HATPase_c_3 N-Term_TEN
Motif
Other DBs
NCBI-ProteinID: ALS25045
UniProt: A0A0U2WC22
LinkDB All DBs
Position
4757073..4760156
Genome map
AA seq 1027 aa AA seqDB search
MGKWDGLGERTMRKKIAAAIVTLTILAATYGLFLVYFSLGGKQTPRAENGFLDLTAWRFA
DDGVVPLDGEWEFYPDKLLSHEDFASSFAHASGLSPERIEVPGSWSNRMKTLGMATYRLR
IKVGDSASVYGLKTSSIQMSNRIIVNGQVAGQSGNPAEGRNYEAVNRPYVSYFTLKTGWN
EIIVQVANFEFPASSGINESIYLGSAAQISGLRDKALAHDWITFTAFLMMGLYFIGLYSQ
RKDDTSLIVFGMVCVFFALFTSTRGERVLFSLFGSVPFWLYLRIQMVSALGAGMGFLLYV
YTAFRPFCSRWLIRIGVVVGTALAVWAIGFIPRFATDLFRQLVTIYATFPLLYAIYVFVL
AAFRKVEGSLYLAVAAIALNVYALVQNLNVYFAVPVDSVPPFEPFVFLLMLALLMSLRFS
NAFRKIEELTVQLLKADKLKDDFLARTSHEFKSPLHGVMHISRSMLDNANHPPSAEQREK
LQLITSITGRLSQLVYDILDFSRLKQGELSVDPTPIDVRSAVEMQVRIYSFLCADRNIRL
ENRVPEHLPYALADESRFSQIVGNLLDNAVKHTENGSIVVTAAENGGMIEVSVRDTGEGI
EAQHIPHLFEAFQSFDERAERRGFGLGLSIVKQLVELQHGSISVISTRGVGTTFTFTLPI
AGGGGKPETAFRASGQPVKAPEYTFTTPHYLNQKGKHTVLIVDDQFLNLKVLMDALEPLG
YNVIAVKNGYEALEQIAKPNKIDLVVLDLMMPGLSGYEVCQEIRKSWTLPELPVLMVTAA
IGPQDKVAAFEAGANDFLPKPFDLAELKARIGSLLAMKESLAKAVDLEVAFLQSQIKPHF
LYNVLNSIVASSYTDAERSRKMTTDLADYLRGSFRFSNAEHRITFEEEFSLIRTYVEIEK
ARFKDRLRFEVDIAEGMFQVSLPPLLLQPLIENAIRHGIGHRVEGGTVKLTAYEAEGEYR
FVIEDNGVGIESKLPGELSVSGSDKRQGVGLLNINKRLKYEYGTELRMESEPGRGTKVTV
RIPAESA
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaatgggatggtctgggtgagcggacgatgagaaaaaagattgcagcggcgatc
gtaacgctgaccatattggccgcaacatacggcctgtttctcgtttatttctcgctgggc
gggaagcagacgccaagagcggaaaacggatttctcgatttgaccgcgtggcggttcgcg
gacgatggcgtcgttccattggacggcgaatgggagttttacccggacaagctcctctct
catgaagatttcgcatcctccttcgcgcatgcaagcggcctttcaccggagcgaatcgaa
gtgccgggatcgtggtcgaatcgaatgaagacgctcggcatggcgacgtaccgtctgcgg
atcaaagtcggcgattctgcgtccgtttacgggctgaaaacatcgtcgatccaaatgtcc
aatcgcatcatcgtcaatggccaggtcgcgggccaaagcgggaatccggcagaagggcgg
aactatgaagcggtaaatcggccctatgtcagctattttacgctaaagaccggatggaac
gaaatcattgtgcaggtggccaacttcgagtttcccgccagcagcggcatcaacgaatcg
atctatctgggatctgcagcgcaaatttccgggctgcgcgacaaggccctcgcccatgat
tggattacgttcacagcctttctgatgatggggctctatttcatcgggctgtattcgcag
cgcaaggacgatacttccctgattgtgttcgggatggtatgcgtgtttttcgccctgttc
accagcacgcgcggcgaaagagtgttgttcagtctgttcggctccgttccgttctggctt
tatcttcgcattcagatggtttcggcgcttggcgcaggcatgggatttctcctgtacgtg
tatacggcgttccgtccgttttgctcccgatggttgatccggatcggggtggtcgtcggg
acggctctggcggtctgggcaatcggcttcatcccccggttcgcgacggatctgtttcgg
caactggtcacgatctacgccaccttcccgctgctgtatgcgatttatgtcttcgtcctg
gcggcattccgcaaagtggagggaagcctgtacctggccgtcgccgcgatcgccctgaac
gtctatgcgctggtgcaaaatctgaacgtttatttcgccgtaccggttgattcggtgccg
ccgttcgaaccgttcgtgttccttctgatgctggctttgctcatgtcgctccggttctcc
aacgcgtttcggaaaattgaagagctcaccgttcaattgctgaaagcggacaagctgaaa
gacgactttctggcaagaacgtcgcacgagttcaagtcgccgctgcacggcgtcatgcat
atctccaggtcgatgcttgacaacgccaatcatccgccctcggcggagcagcgggaaaaa
cttcaattaatcacgagcatcaccggcaggctttcacagcttgtttacgatattctggat
ttttccaggctgaaacaaggcgaattgtccgttgatccgacgccgatcgatgtccgttcg
gccgtcgagatgcaggtgcgcatctattcgtttctgtgcgcggaccgcaacattcggctc
gagaaccgcgtccccgaacatttgccctatgcgcttgccgatgaaagccggttcagccag
atcgtcggcaatctgctcgacaacgcggtcaagcatacggagaacggaagcatcgtcgtc
acagcggcggagaatggcggcatgattgaagtctcggtccgggacacgggcgaaggcatc
gaggcgcagcacatcccgcacctgttcgaagcgttccaatcgttcgacgagcgagcggaa
cgccgcggcttcgggctcgggctgtccattgtcaaacagctggttgagctgcagcatgga
tcgatatcggtaatctcgacgagaggcgtcggcacgacgttcacgttcacgctgccgatc
gcaggtggcggcgggaaaccggaaacggctttccgggcaagcggacaaccggtcaaagcg
ccggagtacacgttcacgacgccccattatctgaatcaaaaagggaagcatacggttctg
atcgtggatgaccaattcctgaatctgaaagtattgatggacgcgctggagccccttggc
tataacgtcattgccgtcaaaaacggctacgaggcgctggaacagatcgccaaaccaaat
aaaattgatcttgtcgttctcgacctgatgatgccgggcctgtcggggtacgaagtgtgc
caggagatccgcaaaagctggacgctgccggagcttcccgtgctgatggtgacggcggcc
atcgggccgcaggacaaggtggcggcgttcgaggcgggtgcgaacgattttctgccgaag
ccgttcgacctggcggagctgaaggcgagaatcggcagcttgctcgcgatgaaggagtcg
cttgccaaggcggtcgatctggaggtggcgtttctgcaatcgcagatcaagccgcatttt
ttgtacaacgtcttgaacagcattgtcgcctcaagttatacggatgcggaacgttcgcga
aaaatgacgacggatctggccgattatttgcgcggcagcttccggttcagcaatgcggag
catcggatcacctttgaggaagagttcagcctgatccggacttacgtcgaaattgaaaaa
gcgcgcttcaaggatcgtttgcgtttcgaagttgacattgcggaagggatgttccaggtg
agcctccctcccctgttgctgcaaccgctcatcgaaaatgcgattcggcacgggatcggc
catcgggtcgaaggcggaacggtaaaattaacggcttatgaggcggagggcgagtaccgg
tttgtgattgaggataacggcgtcggcatcgagagcaagctgccgggtgagctgtcggtt
tccggatcggacaagcgtcagggcgtcggtcttttgaacatcaacaagcggttgaaatac
gaatacggcacggagctgcggatggaaagcgagccgggccggggaacgaaagtgacggtg
cggattccggcggagtcggcgtga

DBGET integrated database retrieval system