KEGG   Pandoraea norimbergensis: AT302_01495Help
Entry
AT302_01495       CDS       T04226                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pnr  Pandoraea norimbergensis
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT302_01495
Enzymes [BR:pnr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AT302_01495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO FAD_oxidored HI0933_like NAD_binding_8 Thi4 Glutaredoxin K_oxygenase FAD_binding_3 FMO-like DUF2190
Motif
Other DBs
NCBI-ProteinID: ALS58652
UniProt: A0A0U2XWD6
LinkDB All DBs
Position
complement(4702798..4704387)
Genome map
AA seq 529 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIALWLDDSPKAAEMKALVEEIAPLSTRITVVARDDAGE
RRPSFAIGAPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTVEQIRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQGEVEARQVMAVPTVYLNGES
FTQGRTSVKELLAKLDTGASARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGITTGV
VAERFGGQVLDTMAIENFISVTHTEGPKFAAALEQHVKAYDVDVIDTQRADALVPGKIHE
VRLASGAVLKARSIVLATGARWREIGVPGERDYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGVVKEVTLIEYGTQLRADEVLQRKLRSLPNVRVLMNAQTTEIVGDGQKV
NGLVYRDRASGETTTVALEGVFVQIGLVPNTEWLKGTLALSRHGEIEVDAKGATSIPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVDDEVDVQREAVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtacctccagaaagtcacgcgcccg
atcgagatcgcgctgtggctcgacgacagccccaaggcggccgagatgaaggcgctggtc
gaagagatcgcgccgctctcgacgcgcatcaccgtcgtggcacgcgatgacgcaggcgag
cgtcgtccttcgttcgccatcggggcgccgggcgaggcaccgcgtatccgttttgcgggt
ttgccgatggggcacgaattcacgtcgctggtactggcgctgctgcaagtgggcggccac
ccggtcaagctcgacgacgacaccgtcgaacagattcgcgccctcgacggcgatttccgt
ttcgaaacctatatctcgctgtcgtgccagaactgcccggaagtcgtgcaggcactgaac
gtcatggcgctcatcaacccgcggattcagcaggtgaccatcgacggcgcgctgtttcag
ggcgaagtcgaagcgcgtcaggtgatggccgtgccgacggtgtatctcaacggcgagtcg
ttcacgcaaggccgtaccagcgtgaaggaactgctcgccaagctcgataccggtgcgagt
gcacgggcagcaaaagcgcttgaaaacaagccggtctacgacatgctgatcgtcggcggc
ggcccggcgggtgcggcggccgcgatctacgcggcgcgtaaaggcatcacgacgggcgtc
gtggccgagcgcttcggcggtcaggtgctcgacacgatggcgatcgagaacttcatttcg
gtcacgcacacggaaggcccgaagtttgccgccgcgctcgaacaacatgtgaaggcgtat
gacgtcgacgtgatcgatacgcaacgcgccgacgcgctggtgccgggcaagattcacgaa
gtgcgtctcgcgagcggtgcggtgctcaaggcccgttcgatcgtgctggccaccggtgcg
cgctggcgcgaaatcggcgtgccgggcgagcgcgactaccgcaatcgcggcgtggcgtac
tgcccgcactgcgacggcccgttgttcaagggcaagcgtgtggccgtggtgggtggcggc
aactccggtgtggaagcggcgatcgatctggccggtgtggtcaaggaagtcacgctgatc
gaatacggcacgcaactgcgcgctgacgaagtgcttcagcgcaagctgcgcagtctgccg
aatgtgcgcgtgttgatgaatgcgcaaacgacggaaatcgtcggcgacggccagaaggtg
aacggtctggtgtatcgcgaccgtgcctcgggcgaaacgacgaccgtggcactggaaggc
gtgttcgtgcagatcggtctggtgccgaataccgaatggctcaagggcacgctggccctg
tcgcgtcacggcgagatcgaagtcgatgcgaagggtgccacgtcgattccgggcgtgttc
gcggcgggcgatgtgacgacggtgccgttcaagcagattgtcattgcggtaggcgagggc
gcgaaggcatcgctgggcgcgttcgagcacctgatgctcagctcggtggatgacgaggtc
gacgtgcagcgtgaagctgtcgcggcctga

DBGET integrated database retrieval system