KEGG   Pandoraea norimbergensis: AT302_14820Help
Entry
AT302_14820       CDS       T04226                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00550  Peptidoglycan biosynthesis
pnr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AT302_14820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AT302_14820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pnr01011]
    AT302_14820
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pnr03036]
    AT302_14820
Enzymes [BR:pnr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AT302_14820
Peptidoglycan biosynthesis and degradation proteins [BR:pnr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AT302_14820
Chromosome and associated proteins [BR:pnr03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    AT302_14820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ALS60846
UniProt: A0A0U2XP93
LinkDB All DBs
Position
complement(1474919..1476703)
Genome map
AA seq 594 aa AA seqDB search
MQKKRQPKDVTFSASPVLQSRMSLWRSKLVVIVITLAFIGLVVRAFWIAGPGNGFYIAQG
EKRYEHTIVMPAVRGKIEDRDGRVLATSLPMRTVWAVPTEVPDDLSDSDIQQASKLLDMP
AKDLRSKLIGEKKFVYIKRQVSPEIGKQIEALGIPGVYESSEYKRFYPEGDVAAHVVGFT
NVEDKGQEGMELGEEPLLEGAAGVRRVIKDRIGRTIQDLDDSSPPRDGKDIRLTLDTRVQ
YIAYEALKNALDRTGAKAAMAVVIDAKTGQVLALANFPTYNPNDREHLTGEQLRNRVFTD
VFEPGSILKPFTMALALDLHRLTPATLIDTGPGRYVFEGATISDDSANGVLTAAGVIQKS
SNIGMTKVSTMLRAEEMWDMFTEIGLGQQPKLGFPGAVSGRLRPYKSWRRIEQATMAYGY
GISASLFQLARAYTIFANDGVLVPITIIKPDAQVQPEGVRVIDSRTASEMRKMLAAVVDT
GGTATTAQVAGYSIGGKTGTAYKAGVHGYDHSKYRASFVGIAPLSAPRLVIAVSVDEPKA
SQHFGGQAAGPAFAEIASQALPLLGIRPDLPVKPGVILAAPTTDTPADDPGPHG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaacgccagcccaaggacgtcacgttctccgccagtccggtccttcaatcg
cgcatgtcgttgtggcgctccaaacttgtcgtcatcgtcatcaccctcgcgttcatcggt
ttggtcgtgcgagccttctggattgcggggcccggcaacggcttctacatcgcgcagggt
gaaaagcgttacgagcacaccatcgtcatgccggccgtgcgcggcaagatcgaagaccgc
gacggtcgcgtgctggccaccagcctgcccatgcgcaccgtgtgggccgtgccgaccgaa
gtaccggacgacctgtccgacagcgatatccagcaagcgagcaagttgctcgacatgccc
gctaaggacttgcgcagcaagttgatcggcgagaagaaattcgtctacatcaagcggcag
gtatcgcccgagatcggcaagcagatcgaagcgctgggcattcccggcgtgtacgagagc
agcgagtacaagcgtttctatcccgaaggcgacgttgccgcccacgtcgtgggtttcacc
aacgtcgaggacaagggacaggaaggcatggagttgggcgaagagcccttgcttgaaggc
gcagccggggtacggcgggtcatcaaggaccgtatcggccgcaccattcaggatcttgac
gactccagcccgccgcgcgacggcaaggacattcgcctgacgctcgacacccgcgtgcag
tacatcgcgtacgaggcgttgaagaacgcactggatcgcaccggcgcgaaggcggcgatg
gccgtcgtcatcgatgccaagaccggacaggtgctggcactcgccaatttcccgacgtac
aaccccaacgatcgcgagcatttgaccggtgagcagttgcgcaaccgggtgttcaccgac
gtattcgagccgggttcgattctcaagccgttcaccatggcgttggcgttggacttgcat
cgtctgacgccggccaccctcatcgacaccggcccgggccggtatgtgttcgagggggcg
accatcagcgacgatagcgcgaacggggtattgacggcggcgggtgtgattcagaagtcg
agcaacattggcatgaccaaggtgtcgaccatgttgcgggcggaggagatgtgggacatg
ttcaccgagattgggttgggtcagcagccgaagctcggtttcccgggggccgtctcggga
aggttacgtccgtataaatcgtggcggcgcattgagcaggcgacgatggcgtatggctat
ggtatttcggcgtcgttgttccagttggcgcgtgcgtacaccatctttgcgaacgatggg
gtgttggtaccgatcacgatcatcaagccggacgctcaggtgcagccggagggcgtacgc
gtgattgatagtcgtacggcatcggagatgcgaaagatgttggcggccgtggtggatacg
gggggtacggcgacgacggcgcaggtggcgggatacagcattggcggcaaaacgggtacc
gcgtacaaggcgggtgtgcacggctacgatcactcgaagtatcgggcgtcgtttgtgggg
attgcgccgttgtcggcaccgagattggtgattgcggtgtcggtggatgagccgaaggca
tcgcagcactttgggggacaggcggcgggcccggcgtttgcggagattgcatcccaagcg
ttgcccttgttgggcatcaggccggacttgccggtgaagccgggcgtgatattggctgcc
ccgaccacggatacaccagcggacgatccgggaccgcatggatag

DBGET integrated database retrieval system