KEGG   Pandoraea norimbergensis: AT302_15490Help
Entry
AT302_15490       CDS       T04226                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00480  Glutathione metabolism
pnr01100  Metabolic pathways
pnr01110  Biosynthesis of secondary metabolites
pnr01120  Microbial metabolism in diverse environments
pnr01130  Biosynthesis of antibiotics
pnr01200  Carbon metabolism
pnr01210  2-Oxocarboxylic acid metabolism
pnr01230  Biosynthesis of amino acids
Module
pnr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT302_15490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT302_15490
Enzymes [BR:pnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AT302_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALS60957
UniProt: A0A0U2XLA7
LinkDB All DBs
Position
complement(1640780..1643020)
Genome map
AA seq 746 aa AA seqDB search
MSKQQPSIIYTLTDEAPLLATSSFLPIIRTFAAPAGVAVETSDISVSGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPDTNIIKLPNISASVFQLQSAIKELQSKGYKIPDFPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGKWSMASRTHVAHMTH
GDFYHGEKSMTIDRARDVKMELVTTSGKTIVLKPKVSLLDGEIIDSMFMSKKALCEFYEA
QMEDARETGVMFSLHVKATMMKVSHPIVFGHAVKIFYKDAFEKHGKLFDQLGVNVNNGLV
NLYEKLETLPSTQREEVIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDYDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNQRAKILAKTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAAQKDDAELPKQFASLAKQLTENEKTIVGELADVQGKPTDIGGYYK
PDFAKLDLVMRPSKTFNAALESVAKA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcagcaacccagcatcatctacaccctgaccgacgaagcgccgcttctggcc
acgagctccttcctcccgatcattcgtacgtttgctgcgccggccggcgtggcggtcgag
acgagcgacatttcggtctcgggccgtatcctcggtgagttccccgaattcctgacggaa
gaacagcgcgtgccggacaatctggccgaactgggccgtctgacgcaagacccggacacg
aacatcatcaagctgccgaacatcagcgcatcggtgttccagctccagagcgcgatcaag
gaattgcaatcgaagggttacaagatccccgacttcccggaagatccgaagaccgacgaa
gaaaaggccattcaaaagcgctattcgaagtgcctcggctcggccgtgaacccggtcctg
cgtgaaggcaactcggatcgccgcgccccgctcgccgttaagaactacgccaagaagcac
ccgcacagcatgggcaagtggagcatggcttcgcgtacccacgtcgcgcacatgacgcat
ggcgacttctatcacggcgaaaagtcgatgacgatcgatcgcgcacgtgacgtcaagatg
gaactcgtcacgacgagcggcaagacgatcgtgctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggccctgtgcgagttctacgaagca
cagatggaagatgcgcgcgagaccggtgtcatgttctcgctgcacgtgaaagccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggacgcc
ttcgagaagcacggcaagctgttcgaccaactgggcgtgaacgtcaacaacggcctggtc
aatctgtacgaaaagctcgaaacgctgccgagcacgcagcgcgaagaagtcatccgcgat
ctgcacgcgtgccatgagcaccgtccggaactcgcgatggtcgattcggccaagggcatc
tcgaatctgcacgccccgaacgacgtgatcgtcgacgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggtgccgatggccgtccgaaggacaccaaggccgtgattccg
gaaagcacgttcgcgcgcatctatcaggaaatcatcaacttctgcaaaaccaacggcaac
ttcgacccgaccacgatgggtacggtgccgaacgtgggcctgatggcgcagaaggcggaa
gagtacggctcgcacgacaagacgttcgagatcgccgaagacggcgtggcgaacattgtc
gacatcgcgaccggcgaagtcctgctgtcgcaaaacgtggaagccggggacatctggcgt
atgtgccaggtcaaggacgcaccgatccgcgactgggtgaagctcgccgtgaaccgcgtg
cgcaactcgggcatgccggctgtgttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgaaacgtacctgaaggattacgacaccaacggtctcgatatccag
atcatgtcgcaagtgcgcgccatgcgttacaccctcgagcgcgtgattcgcggtctggac
accatctcggttaccggcaacattctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgaaacgggtgcaggcggttcggcaccgaagcacgtcaagcaactggtggaagaaaac
catctgcgttgggactcgctcggcgaattcctcgcactggccgtgtcgctggaagacctg
ggcatcaagacgggtaaccaacgcgccaagattctcgccaagacgctcgacgctgccacg
ggcaagctgctcgacaacaacaagggtccgtcgccgaagaccggcgagctggacaaccgc
ggcagccagttctatctgtcgatgtactgggcacaagaactggccgcgcagaaggacgac
gccgagctgcccaagcaattcgcatcgctggccaagcaactgaccgagaacgagaagacc
atcgttggcgaactcgccgacgtacaaggcaagccgaccgacatcggcggctactacaag
ccggacttcgcgaagctcgatctggtcatgcgcccgagcaagacgttcaacgccgcgctg
gaaagcgtcgcgaaggcgtaa

DBGET integrated database retrieval system