KEGG   Pandoraea norimbergensis: AT302_15490Help
Entry
AT302_15490       CDS       T04226                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00020  Citrate cycle (TCA cycle)
pnr00480  Glutathione metabolism
pnr01100  Metabolic pathways
pnr01110  Biosynthesis of secondary metabolites
pnr01120  Microbial metabolism in diverse environments
pnr01130  Biosynthesis of antibiotics
pnr01200  Carbon metabolism
pnr01210  2-Oxocarboxylic acid metabolism
pnr01230  Biosynthesis of amino acids
Module
pnr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT302_15490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT302_15490
Enzymes [BR:pnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AT302_15490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALS60957
UniProt: A0A0U2XLA7
LinkDB All DBs
Position
complement(1640780..1643020)
Genome map
AA seq 746 aa AA seqDB search
MSKQQPSIIYTLTDEAPLLATSSFLPIIRTFAAPAGVAVETSDISVSGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPDTNIIKLPNISASVFQLQSAIKELQSKGYKIPDFPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGKWSMASRTHVAHMTH
GDFYHGEKSMTIDRARDVKMELVTTSGKTIVLKPKVSLLDGEIIDSMFMSKKALCEFYEA
QMEDARETGVMFSLHVKATMMKVSHPIVFGHAVKIFYKDAFEKHGKLFDQLGVNVNNGLV
NLYEKLETLPSTQREEVIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDYDTNGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNQRAKILAKTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAAQKDDAELPKQFASLAKQLTENEKTIVGELADVQGKPTDIGGYYK
PDFAKLDLVMRPSKTFNAALESVAKA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcagcaacccagcatcatctacaccctgaccgacgaagcgccgcttctggcc
acgagctccttcctcccgatcattcgtacgtttgctgcgccggccggcgtggcggtcgag
acgagcgacatttcggtctcgggccgtatcctcggtgagttccccgaattcctgacggaa
gaacagcgcgtgccggacaatctggccgaactgggccgtctgacgcaagacccggacacg
aacatcatcaagctgccgaacatcagcgcatcggtgttccagctccagagcgcgatcaag
gaattgcaatcgaagggttacaagatccccgacttcccggaagatccgaagaccgacgaa
gaaaaggccattcaaaagcgctattcgaagtgcctcggctcggccgtgaacccggtcctg
cgtgaaggcaactcggatcgccgcgccccgctcgccgttaagaactacgccaagaagcac
ccgcacagcatgggcaagtggagcatggcttcgcgtacccacgtcgcgcacatgacgcat
ggcgacttctatcacggcgaaaagtcgatgacgatcgatcgcgcacgtgacgtcaagatg
gaactcgtcacgacgagcggcaagacgatcgtgctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggccctgtgcgagttctacgaagca
cagatggaagatgcgcgcgagaccggtgtcatgttctcgctgcacgtgaaagccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggacgcc
ttcgagaagcacggcaagctgttcgaccaactgggcgtgaacgtcaacaacggcctggtc
aatctgtacgaaaagctcgaaacgctgccgagcacgcagcgcgaagaagtcatccgcgat
ctgcacgcgtgccatgagcaccgtccggaactcgcgatggtcgattcggccaagggcatc
tcgaatctgcacgccccgaacgacgtgatcgtcgacgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggtgccgatggccgtccgaaggacaccaaggccgtgattccg
gaaagcacgttcgcgcgcatctatcaggaaatcatcaacttctgcaaaaccaacggcaac
ttcgacccgaccacgatgggtacggtgccgaacgtgggcctgatggcgcagaaggcggaa
gagtacggctcgcacgacaagacgttcgagatcgccgaagacggcgtggcgaacattgtc
gacatcgcgaccggcgaagtcctgctgtcgcaaaacgtggaagccggggacatctggcgt
atgtgccaggtcaaggacgcaccgatccgcgactgggtgaagctcgccgtgaaccgcgtg
cgcaactcgggcatgccggctgtgttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgaaacgtacctgaaggattacgacaccaacggtctcgatatccag
atcatgtcgcaagtgcgcgccatgcgttacaccctcgagcgcgtgattcgcggtctggac
accatctcggttaccggcaacattctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgaaacgggtgcaggcggttcggcaccgaagcacgtcaagcaactggtggaagaaaac
catctgcgttgggactcgctcggcgaattcctcgcactggccgtgtcgctggaagacctg
ggcatcaagacgggtaaccaacgcgccaagattctcgccaagacgctcgacgctgccacg
ggcaagctgctcgacaacaacaagggtccgtcgccgaagaccggcgagctggacaaccgc
ggcagccagttctatctgtcgatgtactgggcacaagaactggccgcgcagaaggacgac
gccgagctgcccaagcaattcgcatcgctggccaagcaactgaccgagaacgagaagacc
atcgttggcgaactcgccgacgtacaaggcaagccgaccgacatcggcggctactacaag
ccggacttcgcgaagctcgatctggtcatgcgcccgagcaagacgttcaacgccgcgctg
gaaagcgtcgcgaaggcgtaa

DBGET integrated database retrieval system