KEGG   Pandoraea norimbergensis: AT302_17170Help
Entry
AT302_17170       CDS       T04226                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pnr01100  Metabolic pathways
pnr01110  Biosynthesis of secondary metabolites
pnr01130  Biosynthesis of antibiotics
pnr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT302_17170
Enzymes [BR:pnr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     AT302_17170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ALS61247
UniProt: A0A0U2WBN5
LinkDB All DBs
Position
2024243..2025346
Genome map
AA seq 367 aa AA seqDB search
MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALTEADIQVELDRRRPGTSRHVTQRN
EPDAVEILSGVFEGVTTGTPIALLIRNTDQRSKDYGNIVETFRPGHADYTYWQKYGVRDY
RGGGRSSARLTAPVVAAGAVAKKWLAERYGVQIHGCMTQLGDIEVPQTDWSQVSQNPFFA
ANADVVPQLEAYMDDLRKAGDSVGAKLRVVATGVPVGLGEPLFDRLDADIAHAMMGLNAV
KGVEIGAGFRSVTQKGSEHGDELTPEGFVGNNAGGILGGISTGQDVDVSIAIKPTSSIRT
PRRSIDKAGDAATVETFGRHDPCVGIRATPIAEALLALVLIDHALRHRAQCGDVHVGTPV
IASHAPE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatacgcttggaaccctgtttaccgtcaccactttcggcgaatcgcatggc
ccggccatcggttgcgtcatcgacggctgcccgccgggaatggcgctcacggaagccgac
atccaggtcgagctggatcgccgccgccccggcacgtcgcgccatgtcacccagcgcaac
gagcccgatgccgtcgagattctctccggtgtcttcgagggcgtgacgacgggcaccccc
atcgccttgctcatccgcaatacggatcagcgcagcaaggactacggcaatatcgtcgag
acgttccgtcccggccatgccgactacacctactggcagaaatacggcgtgcgcgattat
cgcggcggcggccggtcgtcggcacgtctgacggccccggtggtggcagcaggtgccgtt
gccaagaagtggctggccgagcgctatggtgtgcagattcacgggtgcatgacgcaactc
ggcgatattgaagtgccgcagaccgattggtcgcaagtgtcgcaaaacccgttcttcgca
gcgaatgccgacgtcgtgccgcaactcgaagcctatatggacgacctgcgcaaggcgggc
gactccgtcggcgcgaagctgcgtgtggtcgcgacgggcgtgccggtcggtctgggcgag
ccgctgttcgatcgcctcgatgccgacattgcacacgcgatgatgggcctcaacgccgtg
aagggtgtcgagatcggtgcgggtttccgcagcgtgacgcaaaagggctctgagcacggc
gacgagctgaccccggaaggcttcgtcggcaacaatgccggcgggattctgggcggtatt
tccaccgggcaggatgtcgatgtttcgatcgccatcaagccgacctcaagcattcgcacg
ccgcgccgttccatcgacaaggccggcgatgcggcgacggtcgagacgttcggacgtcac
gacccgtgtgtgggcattcgcgcaacgccgattgccgaggcgctgctggccttggtgctg
atcgaccacgcactgcgccatcgtgcgcaatgtggcgacgttcacgtcggcacgccggtg
attgcttcacacgcaccggagtaa

DBGET integrated database retrieval system