KEGG   Pandoraea norimbergensis: AT302_24505Help
Entry
AT302_24505       CDS       T04226                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pnr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AT302_24505
Enzymes [BR:pnr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT302_24505
Transporters [BR:pnr02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT302_24505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ALS63527
UniProt: A0A0U2NKD6
LinkDB All DBs
Position
complement(3743135..3743794)
Genome map
AA seq 219 aa AA seqDB search
MLKLYGFPISNYYNKVKVVLYEKGVAFEESESIPSQDEPLLQCSPLGKVPYLQTERGYLA
ESQVICDYLEVTHPTPALFSKDVWQQAKERELITMLELHLELVAREVYGQAFFGGTASEG
TRARTEKLLRRNIVAFKRLAKFAPYVAGEQFTMADVAAGIHLPIIGMATQAVFGEDFLQA
AGVDWKAYGKVLAERESFQRTRAEMKAYQQAQQAKKSEA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttgtacggatttccgatcagcaattactacaacaaggtcaaggtcgtgctg
tacgagaagggggtggccttcgaggagtcagaatccattccgagtcaggacgagccgctg
ctgcaatgctcgccgctgggcaaggtgccgtatctgcaaaccgagcgtggctatctcgcc
gagtcgcaggtgatctgcgattacctcgaagtcacgcacccgacgcccgcgctgttttcc
aaagacgtctggcagcaggccaaagagcgcgagctgatcacgatgcttgagctgcatctg
gagttggtggcgcgtgaggtctacgggcaggcgttcttcggcggtaccgcgtcggaaggc
acgcgtgcacgcaccgagaagctgctccgccgcaatatcgtcgcgttcaagcgacttgcg
aagttcgcgccgtatgtcgccggggagcagttcactatggccgacgttgccgccggcatc
cacctgccgatcatcggtatggcgacgcaggccgtgttcggcgaagacttcctgcaagcc
gcgggtgtcgactggaaggcgtacggcaaagtgctcgccgagcgcgaatcgttccagcgc
acgcgcgccgagatgaaggcttatcagcaggcgcaacaagccaagaagtcggaagcgtaa

DBGET integrated database retrieval system