KEGG   Porphyrobacter neustonensis: A9D12_05040Help
Entry
A9D12_05040       CDS       T04416                                 

Definition
(GenBank) AMP-dependent synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00061  Fatty acid biosynthesis
pns00071  Fatty acid degradation
pns01100  Metabolic pathways
pns01212  Fatty acid metabolism
pns02024  Quorum sensing
Module
pns_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9D12_05040
   00071 Fatty acid degradation
    A9D12_05040
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A9D12_05040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pns01004]
    A9D12_05040
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pns04147]
    A9D12_05040
Enzymes [BR:pns01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     A9D12_05040
Lipid biosynthesis proteins [BR:pns01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   A9D12_05040
Exosome [BR:pns04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   A9D12_05040
  Exosomal proteins of breast cancer cells
   A9D12_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ANK14103
UniProt: A0A192D6H6
LinkDB All DBs
Position
complement(1062051..1063850)
Genome map
AA seq 599 aa AA seqDB search
MLQDIDNAQNLVALFLNRADEKGDAPFLGHKAGGQWVTQSWRSAAEHVCLLAEALRAMGL
SDGDRVALVSENRPEWCIADLAIMAAGCITVPTYTTNTRRDHAHILDNSGARAVVVSNEK
LLTPLVGAIGQTGLVEHVIGIDNLKRQQSGSFEYHHWAALVTGDAAAARAAVDARIKDIA
REDTACLIYTSGTGGAPRGVMQHHGMILCNVAGAAEVLIEDFGLKDERFLSFLPLSHAYE
HSGGQYLPIGVGAEIYYSEGLEKLASNIEETRPTIMVVVPRLFEVLRTRIMKQVEKQGKV
AGFMMDAALRIAGNSTEGKTRLIDKPLDFVVERTLRPKIRAKFGGRIKAMVSGGAPLNPE
VGNFFDAMGLTMLQGYGQTEAGPVISCNRPKVGLKMDTVGPPLRGVEVRIAEDGEILVRG
ELVMHGYWRNDAESARTLKDGWLHTGDIGHFDHKGRIKITDRKKDMIVNDKGDNIAPQKV
EGMLTLQPEIAQAMVSGDKRPYVVGLIVPDAEWAVEWARANGEKFDLKGLQDLPAFKNAV
RAAVDRTNADLSVTEKVRQFAFADEAFTIENEEMTPSMKIRRHKIRERYQERIDGLYRG
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atcctgcaggacatcgacaacgcgcagaaccttgtcgcgctgttcctgaaccgcgccgat
gaaaaaggcgatgcgcccttcctcgggcacaaggccggcgggcaatgggtgacgcaaagc
tggcgttcggcggcggagcacgtgtgcctgctcgccgaggcgctgcgcgccatggggctg
tcggatggcgaccgcgtcgctctggtcagcgagaaccggcccgaatggtgcatcgccgat
ctggcgatcatggccgcagggtgcatcacggtgccgacctacaccaccaacacccgccgc
gatcacgcgcacatcctcgacaattcgggcgcgcgcgcggtggtcgtttcgaacgagaag
ctgctgaccccgctggtcggtgcgatcgggcagaccggtctggtcgaacatgtgatcggg
atcgacaatctgaagcgccagcaatcgggcagcttcgaatatcatcactgggccgcgctg
gtcacgggcgatgccgccgcggcgcgcgccgcggtcgatgcccggatcaaggacatcgcg
cgcgaagacaccgcgtgcctgatctacaccagcggcaccggcggcgcgccgcgcggggtg
atgcagcaccacggcatgatcctgtgcaatgtcgcgggcgcggccgaagtgctgatcgag
gatttcggattgaaggacgaacgctttctgtcgttcctgccgctcagccacgcctatgaa
cactcgggcggacaatatctgccgatcggggtgggcgccgaaatctactattccgaaggg
ctggaaaagctcgcctcgaacatcgaggaaacccgtccgacgatcatggtcgtcgtcccc
cgcctgttcgaggtgctgcgcacccggatcatgaaacaggtcgaaaagcaggggaaggtc
gcaggcttcatgatggacgccgcgctccggatcgcgggcaacagcaccgagggcaagacc
cggctgatcgacaagccgctggacttcgtggtcgaacgcacattgcgtcccaaaatccgt
gccaagttcggcgggcggatcaaggcgatggtttcgggcggcgcgccgctcaaccccgaa
gtcggcaatttcttcgacgcgatgggcctcaccatgctgcaaggctacggccagaccgaa
gcggggccggtgatcagttgcaaccgccccaaggtcgggctcaagatggacaccgtcggg
ccgcccttgcgcggggtcgaggttcgcatcgccgaagatggtgaaatcctcgtgcgcggc
gagctcgtcatgcacggctactggcgcaacgatgccgagagcgcgcgcacactcaaggac
ggctggctgcacacgggcgacatcgggcatttcgaccacaagggccggatcaagatcacc
gaccgcaagaaggacatgatcgtcaacgacaagggcgacaatatcgccccgcagaaggtt
gaaggcatgctcacgctccagcccgaaatcgcgcaggcgatggtgagcggggacaagcgg
ccctatgtcgtcggcctgatcgtccccgatgccgaatgggcggtcgagtgggcgcgcgcc
aacggggaaaagttcgatctgaagggcttgcaggatttgcccgcgttcaagaacgcggtg
cgcgctgcggtcgatcgcaccaatgccgatctttcggtcaccgaaaaggtgcgccagttc
gcctttgcggatgaggctttcaccatcgagaacgaggaaatgacgccgagcatgaagatt
cgccgtcacaagatccgcgagcggtatcaggaacggatcgacggcctttatcgcggctga

DBGET integrated database retrieval system