KEGG   Porphyrobacter neustonensis: A9D12_08920Help
Entry
A9D12_08920       CDS       T04416                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00473  D-Alanine metabolism
pns00550  Peptidoglycan biosynthesis
pns01100  Metabolic pathways
pns01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A9D12_08920
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A9D12_08920
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    A9D12_08920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pns01011]
    A9D12_08920
Enzymes [BR:pns01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A9D12_08920
Peptidoglycan biosynthesis and degradation proteins [BR:pns01011]
 Precursor biosynthesis
  Amino acid ligase
   A9D12_08920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ANK13051
UniProt: A0A192D4U2
LinkDB All DBs
Position
1944671..1945624
Genome map
AA seq 317 aa AA seqDB search
MGGWANERPVSLTSGAGVADALESKGHRVTRIDMGRDVALRLHEAKPDVVFNALHGVPGE
DGTVQGMLDLMGLAYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGRIVTREELYERDPL
PRPYVLKPVNEGSSVGVAIVTEDSNVGNPISADARGPWQEFTELLAEPFIKGRELTAAVL
DGPEGPRALGVTELVVASGFYDFENKYTAGRTEHIFPAKLPPEITALCEAYAVKAHQVLG
CHGTSRTDFRWDDEAGEEGLFVLETNTQPGMTPLSLVPEQAAGCGIAYADLVEMLCAEAL
RVHGAKHGGAHGAADPA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggcggctgggccaatgaacgccccgtgtcgctgaccagcggggcgggggtggccgat
gcgctggaaagcaagggccaccgcgtcacccgcatcgatatgggccgcgatgtcgcgctg
cgcctccatgaagccaagcccgatgtcgtcttcaacgcgcttcacggcgtgccgggggaa
gacgggacggtgcagggcatgctcgacctgatgggccttgcctatacccattcgggcctt
gcgacctcggtgatcgcgatcgacaagcagctgaccaaacaggcgttggtgccgcacggt
atcccgatgcccggcgggcggatcgtgacccgcgaagagctgtatgagcgcgatccgctc
ccgcgcccctatgtgctgaaacccgtcaacgaaggatcgtcggtgggtgtcgcgatcgtc
accgaggacagcaatgtcggcaacccgatcagcgccgacgcgcgcgggccgtggcaggaa
tttaccgaattgctcgccgaacccttcatcaagggccgcgaactgactgccgcggtgctc
gacgggcccgaagggccgcgcgcgctgggcgtgaccgaactggtggtcgccagcggcttc
tacgatttcgaaaacaagtacaccgccgggcgcaccgaacatatcttccccgccaagctg
ccgcccgagatcaccgcgctgtgcgaagcctatgcggtaaaagcgcatcaggtgctcggt
tgccatggcaccagccgcaccgatttccgctgggacgacgaagcgggcgaggaaggtctg
ttcgtgctcgaaaccaacacccagccgggcatgacccccttgagcctcgttcccgaacag
gccgcgggctgcggcatcgcctatgccgatctggtggagatgctgtgcgccgaagccttg
cgggtgcacggtgccaagcacggaggcgcgcatggcgcagcagatccggcgtaa

DBGET integrated database retrieval system