KEGG   Porphyrobacter neustonensis: A9D12_09410Help
Entry
A9D12_09410       CDS       T04416                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00790  Folate biosynthesis
pns01100  Metabolic pathways
Module
pns_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A9D12_09410
Enzymes [BR:pns01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A9D12_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ANK13126
UniProt: A0A192D516
LinkDB All DBs
Position
2047301..2048413
Genome map
AA seq 370 aa AA seqDB search
MSARVYLHPLTLVSGPQAVDGAAVRLGGSMAYAREFALVVRKGGTVTERMVGTPREIKAA
IARLSGALADDAAAQWANLAKAHAPLELGARTVRLDQPQVVGILNVTPDSFSDGGRHDAA
EAGRAHAAAMLEAGAAMIDIGGESTRPGAAATFEDEEIGRVRPAVEYCAAMGAAISLDTR
RAGVLMAGLAAGAHMANDVSAMRYDPRMIEVVASQACPVILMHAPGAGEDLHAGASYTDV
VSDVFDFLAAARDRALAAGIAPGRIVLDPGIGFGKSLAENLALMNALPLFHALGCPLMLG
ASRKRMIGALSREEAADARLAGSLALALRGMEAGVHLLRVHDVAETVQARNVWRGLRDTG
LTDFSQLLPL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgcgcgtctatctccacccgctgacgctggtttccgggccgcaggcggtcgac
ggcgcagcggtgcggctgggcgggtcgatggcctacgcccgcgaatttgcgctggtggtg
cgcaaaggcggcacagtgaccgagcgcatggtcggcacgccgcgcgagatcaaggcggcg
attgcgcggctttcgggagcgctggcggatgatgcggcggcgcaatgggccaacctcgcc
aaggcgcacgcaccgctcgaactgggcgcacgcacggtccggctcgaccagccgcaggtg
gtgggcatcctcaacgtcacccccgacagtttctccgatggcggccggcatgacgccgcc
gaggcaggccgtgcgcatgccgccgcgatgcttgaggcaggcgcggcgatgatcgacatc
ggcggggaaagcacgcggcccggcgctgcggcgaccttcgaggacgaggagatcgggcgg
gtccgcccggcggtcgaatactgcgccgcgatgggcgctgcgatcagcctcgacacgcgg
cgtgccggggtgctgatggcgggcctcgcggcgggcgcgcacatggccaacgatgtctcg
gcaatgcgctatgacccgcgcatgatcgaggtggtcgcgagccaggcctgccccgtcatc
ctgatgcacgcacccggcgcaggcgaggatctgcacgcgggtgcaagctataccgatgtg
gtgagcgacgtcttcgatttcctcgccgccgcacgcgaccgggcgctggccgcaggcatc
gcaccagggcggatcgtgctcgaccccgggatcggcttcggcaagtcgctcgccgaaaac
cttgcgctgatgaacgcgctgccgctgtttcatgcgctgggctgcccgctgatgctgggg
gcgagccgcaagcggatgatcggggccctgtcgcgcgaggaagcggcggacgcacgactg
gcgggatcgctggcgctcgcgctcaggggcatggaggcgggcgtccacctgctgcgcgtc
cacgacgtggccgagacggtgcaggcgcgcaatgtctggcggggcctgcgcgataccggg
cttaccgatttcagccagttgcttccgctctga

DBGET integrated database retrieval system