KEGG   Porphyrobacter neustonensis: A9D12_12255Help
Entry
A9D12_12255       CDS       T04416                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pns  Porphyrobacter neustonensis
Pathway
pns00010  Glycolysis / Gluconeogenesis
pns00020  Citrate cycle (TCA cycle)
pns00620  Pyruvate metabolism
pns01100  Metabolic pathways
pns01110  Biosynthesis of secondary metabolites
pns01120  Microbial metabolism in diverse environments
pns01130  Biosynthesis of antibiotics
pns01200  Carbon metabolism
Module
pns_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pns00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9D12_12255
   00020 Citrate cycle (TCA cycle)
    A9D12_12255
   00620 Pyruvate metabolism
    A9D12_12255
Enzymes [BR:pns01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A9D12_12255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ANK13584
UniProt: A0A192D735
LinkDB All DBs
Position
2639583..2641010
Genome map
AA seq 475 aa AA seqDB search
MATDIKMPALSPTMEEGTLAKWLVKVGDTVSSGDVMAEIETDKATMEFEAVDEGVISEIL
VEAGTEGVKVGAVIARLAAEGEEAAPAKAPAAPKDAEAQPKATAPAAPAAADGPAATPTA
KRIAQQNGIDLASLEGTGPKGKVTKEDVEAAIAKAGGKPAAAPAQTSPAAAPSGERIVAS
PLAKRMASDRGIDLGAVTGSGPNGRIVKDDVDNFTPAAQAAPAKADTAAPSETAPAPKPQ
PEIEGGAPYSEEKLSGVRKVIARRLTESKQTVPHFYLTIDIRLDPLLELRSALNKSLEPD
GVKLSVNDLLIKALARALIRVPQCNVSYHGDTLRRYERADISVAVAAPSGLITPVITNAD
TKGLAAISTEMKTLAGKARDGKLMPHEYQGGTASLSNLGMFGIKQFDAVINPPQGMILAV
GAGQQAPYVVDGEIKVATVLHASGSFDHRAIDGADGAQLMEAIKQLVENPMGLVV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgacatcaagatgccggcattgtcgcccacgatggaagaaggcacgctggcc
aagtggctggtcaaggtcggcgacacggtatcatcgggcgacgtgatggccgagatcgag
accgacaaggcgacgatggagttcgaagcggtcgacgagggcgtgatttcggaaattctg
gtcgaggcgggcaccgaaggcgtgaaggtcggcgcggtgatcgcacggctcgcagccgaa
ggcgaggaagcggcccccgccaaggctcccgccgcaccgaaggatgccgaagcccagccc
aaggcaaccgcgcctgccgccccggccgcagccgatggtccggctgcgaccccgaccgcg
aaacggattgcccagcagaacggcatcgatctggcgagccttgaaggcaccggacccaag
ggcaaggtcaccaaggaagatgtcgaggcggcaatcgccaaggccggcggcaagcccgca
gcggcgcccgcacagacctcaccagccgcggccccttcgggcgaacgcatcgtcgcctcg
ccgctggccaagcgtatggcgagcgacaggggcatcgaccttggcgcagtgaccggcagc
ggccccaatggccggatcgtcaaggacgatgtcgacaacttcacgcctgccgcccaagct
gccccggcgaaggcggatactgcggcgccttcggaaacagcaccagcgccaaagccgcag
cccgaaatcgaaggcggcgcgccctattcggaagaaaaactgtcgggcgtgcgcaaggtc
atcgcccgccgcctcactgagagcaagcagaccgtcccgcacttctatctcaccatcgac
atccggctcgatccgctgctggaactgcgcagcgcgctcaacaagtcgctcgagcccgat
ggcgtgaagctgtcggtcaacgacctcctcatcaaggcgctcgcccgcgcgctcatccgc
gtgccgcagtgcaatgtcagctatcacggcgatacgctgcgccggtatgaacgcgccgat
atctcggtcgcggtcgccgcgccctcgggtctgatcacgcccgtcatcaccaatgccgac
accaagggcctcgccgcgatctcgaccgagatgaagacgcttgcgggcaaggcgcgcgat
ggcaagctgatgccgcacgaatatcagggcggcacagcgagcctttcgaacctcggcatg
ttcgggatcaagcagttcgacgcggtgatcaacccgccgcagggcatgatcctcgcggtc
ggggcggggcagcaggcgccctatgtggtcgatggcgagatcaaggtcgcgaccgttctc
cacgcttcgggaagcttcgaccaccgcgccatcgatggcgccgacggcgcgcagctgatg
gaggctatcaagcagctggtcgagaacccgatggggctggttgtttga

DBGET integrated database retrieval system