KEGG   Polynucleobacter asymbioticus: Pnuc_0138Help
Entry
Pnuc_0138         CDS       T00502                                 

Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pnuc_0138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pnu03400]
    Pnuc_0138
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Pnuc_0138
DNA repair and recombination proteins [BR:pnu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Pnuc_0138
 Prokaryotic type
     Pnuc_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ABP33359
UniProt: A4SV45
LinkDB All DBs
Position
complement(132189..132983)
Genome map
AA seq 264 aa AA seqDB search
MPSFSKSDIPEDWRALLGDYFDSPAWKQLELNLQSILDSAPASIYPQPEHFFKALKLTPV
DSVKVVILGQDPYHSPGLAQGLAFSIPADIPLNSRAFPSSLRNISKALALEGFGGLPNGD
LHSWAQQGVLLLNTALSVKPGEAGSHANLGWKSLIDCLITQLALQKPSLVWMLWGGHAQS
KLPLIESGIDQLILQSSHPSGLGVYKTDKPFLEPGAHASCKHFTKANEWLTGHHQAPIQW
ISLNSAVNGIQVDLFSQSGKNTAH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgccttctttttctaagagcgatattcctgaggattggcgcgcactactaggcgactac
tttgattcacctgcctggaagcaattagaacttaatctgcagtccattctagacagtgcg
cctgcaagcatttacccccagcctgagcatttctttaaagctttaaaactaactccagtc
gattcagtcaaagtagtcatcctcggacaagatccgtatcactcgcccggattggcacaa
ggcttggcattctccattcccgctgatatccctttaaactcccgtgcgtttccaagttca
ttacgcaatatcagcaaggcactcgctcttgaggggtttggtggattgccaaacggtgac
ttacattcatgggcacaacaaggcgtgcttctcctaaatacagcactcagcgtaaaacca
ggcgaagcgggaagtcatgccaatctaggatggaaaagcctgattgattgtttaatcact
cagctcgccttacaaaaaccttctttagtgtggatgctttggggaggtcatgctcaatcc
aagctcccattaattgaatctggtattgaccaactcattttgcaatcttcccacccttct
ggattgggcgtttacaaaaccgacaagccttttttagaacctggtgcacacgctagttgt
aaacacttcaccaaagcaaatgagtggcttactggccatcatcaggcgcccattcaatgg
attagtttaaatagcgcggtaaatggcattcaggtggatttatttagccaaagcggtaaa
aatacagcccactag

DBGET integrated database retrieval system