KEGG   Polynucleobacter asymbioticus: Pnuc_0366Help
Entry
Pnuc_0366         CDS       T00502                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00020  Citrate cycle (TCA cycle)
pnu00480  Glutathione metabolism
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01120  Microbial metabolism in diverse environments
pnu01130  Biosynthesis of antibiotics
pnu01200  Carbon metabolism
pnu01210  2-Oxocarboxylic acid metabolism
pnu01230  Biosynthesis of amino acids
Module
pnu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnuc_0366
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pnuc_0366
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Pnuc_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: ABP33586
UniProt: A4SVS2
LinkDB All DBs
Position
360802..363036
Genome map
AA seq 744 aa AA seqDB search
MASEKSKIIYTLTDEAPLLATCAFLPIIRTFTAPAGVEIVNSDISVAARILAEFSECLTT
EQKVPDNLAELGKMTLMPDTNIIKLPNISASVPQLLAAIKELQSKGYKIPNFPEDPKTDE
EKSIRTRYSKCLGSSVNPVLREGNSDRRAPPAVKRYARKNPHSMGEWSQASRTHVSHMHG
GDFYSSEKSMTMTKACDVKMDLVTKSGKTIVLKPKVSLLAGEIIDSMNMSKKALCEFYEK
EIEDAYKTGMMLSLHVKATMMKVSHPIVFGHAVKIFYKDAFEKHAKLFEELGVNANNGMS
SLYEKIKTLPESKREEIIQDLHACHEHRPALAMVDSAKGITNLHSPSDVIVDASMPAMIR
VGGKMWGADGRLHDTKAVIPESTFARIYQEMINFCKTHGNFDPTTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEAGVARIVADDGTVLLEQNVEEGDIWRMCQCKDAPIRDWVKLAVNRAR
LSNTPAVFWLDEYRPHEAELIKKVNTYLKDYDLTGVDIQIMSQTRAMRYTLERVIRGKDT
ISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQLVEENH
LRWDSLGEFLALAVSLEDIGDKTGNNKVKILARTLDEATGTLLDNNKSPSPRTGELDNRG
SQFYLAMYWAKALAAQTEDKELQAYFAPLAKALSENEEKITAEFKAVQGKPVDIGGYFVA
DPEKCKAVMRPSQTFNAALKAARA
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagagaaatcaaagattatttacacgctgacagatgaagcaccgcttttagcg
acttgcgcatttctgcccatcattcgtactttcacagcgcctgctggtgtagagattgtg
aatagcgacatttctgttgctgcacgtatcttggctgaattttctgagtgcttaacgacc
gaacaaaaagttcctgacaatttggcagagcttggcaaaatgactttgatgccagatacc
aacattattaagttgccaaatatcagcgcctctgttcctcagttattagctgcgatcaaa
gaattgcaatcaaaaggctacaagattcccaatttcccagaagatccaaaaacggatgag
gaaaaatcgattcgtacgcgctattccaagtgcttaggtagttcagtaaatccggtattg
cgtgaaggtaactctgaccgccgtgcgccacccgctgttaagcgttacgctcgtaaaaac
ccgcactccatgggtgagtggagccaagcttcccgtacgcacgtatcccatatgcatggt
ggtgacttctactctagcgagaagtcaatgacaatgaccaaggcatgtgatgtcaagatg
gatttagtaactaagagcggcaaaacgattgtgctcaagccaaaggtctctttacttgct
ggcgaaattatcgacagtatgaatatgagtaagaaagccttgtgcgagttctacgaaaaa
gaaattgaagacgcatacaagacaggcatgatgttgtccttgcacgtgaaggcaaccatg
atgaaagtatctcacccaatcgtatttggtcatgctgtcaagattttctacaaagatgct
tttgagaagcatgcgaagctattcgaagagttgggcgtcaatgccaataacggtatgagc
agcctgtatgaaaagattaagactttgcctgaatctaagcgcgaagaaatcattcaagat
ttgcatgcatgccatgagcatcgcccagcattggcgatggttgactctgctaaaggtatc
accaacttgcattctccaagtgatgtgatcgtagatgcctctatgcctgcgatgattcgc
gtaggcggcaagatgtggggtgcggatggtcgtttgcatgacaccaaggccgtgattcca
gagagtacttttgcccgtatctatcaagaaatgatcaatttctgtaagacacacggcaat
ttcgatccaacgacgatgggtactgtacctaacgtgggcttgatggctcagcaggctgaa
gagtatggttcacacgacaagacttttgaaattccagaggctggtgtagcccgcatcgtg
gctgatgatggcactgtgttgcttgagcagaacgtggaagagggcgatatctggcgtatg
tgtcagtgtaaagatgctccgattcgtgactgggtcaagttggctgtgaatcgtgcgcgt
ctttctaataccccagctgtattttggcttgatgagtaccgcccgcatgaagctgaattg
atcaagaaggtaaatacctacctcaaagactatgatcttacgggtgtggatattcagatc
atgtctcagactcgtgcaatgcgttacaccctagagcgcgtcattcgtggcaaagacact
atttctgtaaccggtaacatcttgcgtgactacctcactgacttgttcccaattatggaa
ttaggcaccagtgcgaagatgctttctatcgtacctttgatggctggtggtggcttgttt
gaaaccggtgctggtggttctgctccgaaacacgttcagcagttggtagaagaaaaccat
ttacgctgggattctctcggagagtttttggctctagcggtatctctcgaagatattggc
gataagacaggcaataacaaggtaaaaatcttagcccgtactttggatgaggcgacaggt
actttattggataacaataagtcaccttcaccacgcaccggcgagctagataaccgtggc
agtcaattctatttagccatgtactgggctaaggcattggcagcacaaactgaagacaaa
gaattgcaagcttactttgcacctttggctaaagctttgtcagaaaatgaagagaagatt
acggctgaatttaaggcagttcaaggtaagccagtagatatcggcggttactttgttgct
gatccggaaaagtgcaaagcagtgatgcgcccaagccaaacatttaatgcagctttaaaa
gcggcaagagcttaa

DBGET integrated database retrieval system