KEGG   Polynucleobacter asymbioticus: Pnuc_1217Help
Entry
Pnuc_1217         CDS       T00502                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pnuc_1217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pnu02000]
    Pnuc_1217
Enzymes [BR:pnu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pnuc_1217
Transporters [BR:pnu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pnuc_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_3 GST_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABP34432
UniProt: A4SY68
LinkDB All DBs
Position
complement(1271654..1272313)
Genome map
AA seq 219 aa AA seqDB search
MSKNTTLTISSKNYSSWSLRGWLILKLSGLPFQEIAVHPDDVDNRAELLLLSPSILVPRL
DHDGCKVWDTMAIGEYLNELNPKAHLLPKDPAARAHCRSICGEMHSGFSALRASLPMNIK
GKFASFKVWSKAQIDINRILVIWQDCLSTYGGPFLFGKEPTLADAMFAPVVTRFLTYHVE
LDAASARYCEHIMAMPEMKEWVMGALEEPDDIEELEVEF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagaacaccaccttgacgattagtagcaaaaattactcttcatggtctttgcgt
ggttggctaatcttgaaattatccggactgccttttcaagaaattgctgttcatccggat
gatgttgataacagagcagaactattgttactttcaccgtcaattttggtgcctagactc
gaccatgatggttgtaaggtctgggacaccatggctattggtgaatatctcaatgaatta
aatcccaaagcccatttgcttcctaaagatccagcggctagagcgcattgccgatccatc
tgtggagaaatgcattcaggattttcagcgttgagagcatctttgccgatgaatattaaa
ggcaaatttgcctcctttaaggtttggtcaaaagcccaaattgacatcaatcgaattttg
gtgatttggcaagattgcctctccacatacggtggtcctttcttatttgggaaagagccc
actttggctgatgccatgtttgcaccagtcgttaccagattcctgacttatcacgtagag
ctagatgctgcgagcgcgcgttattgcgaacacatcatggcaatgccagagatgaaggag
tgggtgatgggcgcccttgaagaacccgatgacattgaagaacttgaagtggagttttaa

DBGET integrated database retrieval system