KEGG   Polynucleobacter asymbioticus: Pnuc_1238Help
Entry
Pnuc_1238         CDS       T00502                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00061  Fatty acid biosynthesis
pnu00780  Biotin metabolism
pnu01100  Metabolic pathways
pnu01130  Biosynthesis of antibiotics
pnu01212  Fatty acid metabolism
Module
pnu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pnu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pnuc_1238
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pnuc_1238
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Pnuc_1238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pnu01004]
    Pnuc_1238
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Pnuc_1238
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Pnuc_1238
Lipid biosynthesis proteins [BR:pnu01004]
 Fatty acid synthase
  Component type
   Pnuc_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ABP34453
UniProt: A4SY89
LinkDB All DBs
Position
1302144..1302929
Genome map
AA seq 261 aa AA seqDB search
MSFLSGKKILITGLLSNRSIAYGIAKACHREGAELAFTYVGERFKSRIVDFAQEFNTKLI
FDCDVGSDEQISALFKDLAKSWPQFDGFVHAIGFAPREAIAGDFLEGLSREGFKIAHDIS
AYSFPAMAKEALPMLRDKSSLLTLTYLGSMKNVPNYNTMGLAKASLEASVRYLAGSVGPK
GIRANGISAGPIKTLAASGIKGFGKILEAVEQTAPLRRNVTIDDVGNTAAFLLSDLANGI
TAEIIYVDNGFSQVVGGMDEV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagctttctctccggcaaaaaaatcctcattaccggcctcctctccaaccgctccatc
gcctatggtatcgccaaagcctgccatcgcgaaggtgctgaactcgcctttacctacgta
ggtgagcgctttaagagtcgtattgtcgattttgcacaagaattcaacacaaaactgatt
tttgactgtgatgttggcagtgatgaacaaattagtgccctatttaaggatctagctaaa
tcttggcctcagtttgacggttttgtccacgcgattggctttgctccgcgcgaagcaatt
gctggcgactttttagaaggtctatctcgtgaaggcttcaaaatcgcccatgacatttct
gcttacagctttcctgcaatggctaaagaagcattaccaatgttgcgcgataaatcctct
ttgctcacattgacctatttgggatctatgaaaaatgttcccaactacaacacgatgggt
ttagcgaaggcatcactcgaggcttctgttcgctaccttgctggctctgtaggtcctaaa
ggtattcgtgcgaacggtatttctgctggcccgatcaaaaccttggctgcttctggcatt
aaaggctttggaaaaatccttgaagccgttgagcaaactgcaccattgcgtcgaaacgtt
accattgacgacgttggcaatacagccgcgtttctgttgtctgatttagcaaatggtatt
actgctgaaatcatttatgtggataacggctttagccaagtggttggtggaatggatgag
gtttga

DBGET integrated database retrieval system