KEGG   Polynucleobacter asymbioticus: Pnuc_1626Help
Entry
Pnuc_1626         CDS       T00502                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pnu  Polynucleobacter asymbioticus
Brite
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pnuc_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABP34840
UniProt: A4SZC6
LinkDB All DBs
Position
complement(1694400..1694933)
Genome map
AA seq 177 aa AA seqDB search
MGMNQKQLLIALTAVGVLSLLACQSMEQGTGQKASASLESKSGSQAKGEVNFVWQENDVL
INGKFSGLKPNSEQGIHVHEKGDCSAPDATSAGGHFNPETKMHGVPDSGMNHAGDMPNIK
SDANGNAVYAAKLHGFAVNTGSNGIVGRAVVVHKDPDDYKTQPAGNSGPRIACGVIK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgaatcaaaaacagttattgatcgcattaaccgctgtgggagtactttcatta
cttgcttgccaatctatggagcaaggcaccggtcaaaaagcaagtgcaagcctagagtca
aagtcaggatctcaggcaaagggcgaggttaattttgtatggcaagagaatgatgttttg
attaatggaaagttctctggcctcaagcctaattctgagcaaggaattcacgttcacgaa
aagggagactgctctgcgcctgatgctacgagcgcaggtggacatttcaatccagaaaca
aaaatgcatggcgtacctgatagcggcatgaatcatgctggagatatgcccaacattaaa
tcggatgcaaatggtaacgcagtatatgcagccaagttacatggttttgcagtgaacaca
ggatccaatggaattgtcggccgcgcagttgttgtacataaagatccggacgattacaaa
acccagcctgcaggtaactctggcccaagaattgcctgtggagtgattaagtaa

DBGET integrated database retrieval system