KEGG   Polaribacter sp. ALD11: CW731_08360Help
Entry
CW731_08360       CDS       T05264                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
poa  Polaribacter sp. ALD11
Pathway
poa00240  Pyrimidine metabolism
poa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:poa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CW731_08360
Enzymes [BR:poa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CW731_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AUC85302
UniProt: A0A2K8XQR5
LinkDB All DBs
Position
1868383..1869018
Genome map
AA seq 211 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQSVEIFKPSVDTRYDNDE
VVSHNDNRIRSTPVPAAANIRLLANNIDVVGIDEAQFFDDEIIAVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTHTGNLAHYSFRKAKNDNIVMLGEMQEYEP
LSRAAYYKALQKQKEIILSVKDIEPNLNDTE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcatacagaacaatttggttggattgaagtgatctgc
ggctcgatgttttctggtaaaacagaagaacttattagacgtttaaaacgtgcacaattt
gcaaaacaaagtgtagaaatttttaagccttctgtagatactcgttatgacaatgatgaa
gttgtttctcataatgacaatagaatacgctctacacctgttcctgcagctgcaaatatt
cgtcttttagcaaacaatattgatgttgttggtattgatgaagctcaattttttgatgat
gaaattatagccgtttgcaatgacttagcaaatagaggtattcgcgtaattgtagctggt
ttagatatggattttaaaggaaacccttttgggccaatgccagccttaatggctactgca
gaatatgttaccaaagtacatgctgtttgcacacacactggtaatttagcacattatagc
tttagaaaagccaaaaacgataatattgtaatgttgggtgaaatgcaagaatatgagccg
ttaagtagggctgcatattacaaagctttacaaaaacaaaaagaaattattttatctgta
aaagatattgaacctaatttaaatgatactgaataa

DBGET integrated database retrieval system