KEGG   Polaribacter sp. ALD11: CW731_11100Help
Entry
CW731_11100       CDS       T05264                                 

Definition
(GenBank) hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
poa  Polaribacter sp. ALD11
Pathway
poa00061  Fatty acid biosynthesis
poa00780  Biotin metabolism
poa01100  Metabolic pathways
poa01212  Fatty acid metabolism
Module
poa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:poa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CW731_11100
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CW731_11100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:poa01004]
    CW731_11100
Enzymes [BR:poa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CW731_11100
Lipid biosynthesis proteins [BR:poa01004]
 Fatty acid synthase
  Component type
   CW731_11100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AUC85799
UniProt: A0A2K8XS71
LinkDB All DBs
Position
2513105..2513545
Genome map
AA seq 146 aa AA seqDB search
MNQIEIIKNLPYTNPFLFVEELTEISEDGVTGNYTFNETAFFYEGHFKGNPITPGVILTE
TMAQIGVVCLGIYLLKDEISATEKKPQIALTSNQVDFYLPVLPNEKVTVISEKEYFRFNK
LKCKVKMMNEKNELVCRGTISGMIKA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaatagaaatcataaaaaaccttccttatacaaatccttttttgtttgttgaa
gaactcacagaaatttcagaagatggagttacaggaaattacactttcaacgaaactgcc
tttttttatgaaggtcattttaaaggaaatccaattacaccaggcgttattttaacggaa
acaatggcacaaattggcgttgtatgtttgggtatttatttattaaaagacgaaatttca
gcaacagagaaaaaaccacaaattgcgttaacctctaatcaggttgatttctatttacct
gttttaccaaatgaaaaagtaacggtgatttcagagaaagaatattttagattcaataag
ttaaaatgcaaagtaaaaatgatgaatgagaaaaatgaactggtttgcagaggaactatt
tctggaatgataaaagcttaa

DBGET integrated database retrieval system