KEGG   Polaribacter sp. ALD11: CW731_11245Help
Entry
CW731_11245       CDS       T05264                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
poa  Polaribacter sp. ALD11
Pathway
poa00010  Glycolysis / Gluconeogenesis
poa00053  Ascorbate and aldarate metabolism
poa00071  Fatty acid degradation
poa00280  Valine, leucine and isoleucine degradation
poa00310  Lysine degradation
poa00330  Arginine and proline metabolism
poa00340  Histidine metabolism
poa00380  Tryptophan metabolism
poa00410  beta-Alanine metabolism
poa00561  Glycerolipid metabolism
poa00620  Pyruvate metabolism
poa00625  Chloroalkane and chloroalkene degradation
poa00903  Limonene and pinene degradation
poa01100  Metabolic pathways
poa01110  Biosynthesis of secondary metabolites
poa01120  Microbial metabolism in diverse environments
poa01130  Biosynthesis of antibiotics
Module
poa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:poa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CW731_11245
   00053 Ascorbate and aldarate metabolism
    CW731_11245
   00620 Pyruvate metabolism
    CW731_11245
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CW731_11245
   00561 Glycerolipid metabolism
    CW731_11245
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CW731_11245
   00310 Lysine degradation
    CW731_11245
   00330 Arginine and proline metabolism
    CW731_11245
   00340 Histidine metabolism
    CW731_11245
   00380 Tryptophan metabolism
    CW731_11245
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CW731_11245
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CW731_11245
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CW731_11245
Enzymes [BR:poa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CW731_11245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUC85827
UniProt: A0A2K8XSH9
LinkDB All DBs
Position
complement(2539230..2540771)
Genome map
AA seq 513 aa AA seqDB search
MTDFGIKEALKELGLKDVNNGTSTGSNNFSNGEVIESYSPVDGKLIGKVKSTTKEDYEKV
MEAATKAFLSFRNMPAPQRGEIVRQFGNKLREKKEALGKLVSYEMGKSYQEGLGEVQEMI
DICDFAVGLSRQLNGQTIPSERPGHVMREQWHPIGVVGIISAFNFPVAVWAWNTALAWIC
GDVCVWKGSEKAPLCTVACQNIIAEILKENNLPEGISSIINGDYKVGEMMTNDTRIPLVS
ATGSTRMGRIVGATVAQRFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCGQRCT
STRRLIIHESVYDKVRDAIVGAYGQIKIGNPLDENNHVGPVIDHDSVNTYLAAIEKAKAE
GGNVLVEGGVLEGQGYESGCYVKPAIIEAENHYEIVQHETFAPILYLIKYSGEVENAIAL
QNGVAQGLSSAIMTNEMKEAEKFLSYAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRE
SGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacagactttggaataaaagaagcattaaaagaattaggtttaaaagacgtaaacaac
ggaacctctacaggttctaataatttttctaacggagaagttatagaaagctattctcct
gttgatggaaaactgattggaaaagtaaaatcgaccacaaaagaagactatgaaaaagtg
atggaagctgctacaaaagcatttttatcatttagaaatatgcctgctccacaaagagga
gaaattgtacgtcaatttggtaataaattaagagaaaagaaagaagctcttggtaaatta
gtttcttatgaaatggggaaaagttaccaagaaggtttaggtgaagtacaagaaatgatt
gacatctgtgattttgcagtaggtctatctagacaattaaacggacaaacaattccttct
gaacgtccagggcatgttatgagagaacagtggcatccaattggtgttgttggtattatt
tctgcatttaactttccggtagctgtttgggcttggaacacagctttagcatggatttgt
ggtgatgtatgtgtttggaaaggttctgaaaaagcacctttatgtacagttgcttgtcag
aatattattgccgaaattttaaaagaaaacaatttaccagaaggtatttcttcaattata
aatggagattataaagttggtgaaatgatgaccaatgatactagaattcctttagtttct
gcaacaggttctacaagaatgggaagaattgttggtgcaacggttgcacaacgtttcgga
aaatctttgttagagttaggaggaaacaatgctattattattacaccaactgcagatttg
aaagtagtggttcctggtgctgtttttggtgctgttggaacgtgcggacaacgttgtaca
tctacaagaagattaattattcacgaatcggtttatgataaagtaagagatgccattgtt
ggtgcttacggacaaattaaaataggaaatcctttagatgagaacaatcatgttggtcca
gtaatcgaccacgattcggtaaatacctatttagcagctattgaaaaagcaaaagctgaa
ggtggaaatgtgttggttgaaggtggtgttttagaaggccaaggttacgaaagcggatgc
tatgtaaaaccagctattattgaagctgaaaaccattatgaaattgttcagcatgaaaca
tttgctccaattttatatttaataaaatattctggagaagtagaaaatgctattgcgctt
caaaatggagtagcacaaggtttatcttctgcaattatgaccaatgaaatgaaagaagca
gagaagttcttatcttatgcaggttcagattgtggtattgcaaacgtaaacatcggaact
tctggcgcagaaattggtggtgcttttggaggtgaaaaagaaactggtggtggacgagag
tctggatcagatgcttggaaagtatacatgagaagacagacaaatactgtaaattattct
gatgaattgcctttagcgcaaggaataaagttcgatttataa

DBGET integrated database retrieval system