KEGG   Polaribacter sp. ALD11: CW731_13260Help
Entry
CW731_13260       CDS       T05264                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
poa  Polaribacter sp. ALD11
Pathway
poa00620  Pyruvate metabolism
poa00680  Methane metabolism
poa01100  Metabolic pathways
poa01120  Microbial metabolism in diverse environments
poa01200  Carbon metabolism
Module
poa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:poa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CW731_13260
  09102 Energy metabolism
   00680 Methane metabolism
    CW731_13260
Enzymes [BR:poa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CW731_13260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4378 ECH_1 DUF218 PCI
Motif
Other DBs
NCBI-ProteinID: AUC86186
UniProt: A0A2K8XTV0
LinkDB All DBs
Position
complement(3039170..3041749)
Genome map
AA seq 859 aa AA seqDB search
MSGLSKLSRFNENVLSKYQIYNSIFMTLPFDTISNTGVLLPLFHKLCEKGFQEGKNPTEI
VNTFFSKYQENPTEKEKTDLLFRFIQYIERQVVLFDAIEDAAFPVVNNMDGIGTLRNSKE
TAILSDKKEALKAHLEDFKVRVVLTAHPTQFYPGSVLGIITDLDQAIQNDDLLLIKKLLA
QLGKTPFYKKAKPSPYDEAISLIWYLENVFYHSISKIYNYIQNNIYDGNPMDNEIIDLGF
WPGGDRDGNPFVTTQITLDVAEKLRQSILRSYYRDVKRLKRRFTFDGVQEILARVEKRLY
KHVVRSYSKVNFSQKILLEELSNARQIVADKHQSLFIEELDDFINKVRIFGFHFATLDIR
QDSRVHHQAFTQIVKDLHTIGDSTFPKNYEHLSEEEQIEILAAAKGSIDPKTLTDDTSVS
TIESMYALKQIQKRNGERGANRYIISNNQTALNVMETFAMLNLCGFENGLPVDVIPLFET
VEDLQNAEEVMRTLYSNRTYRYHLEKRKNKQTIMLGFSDGTKDGGYLMANWGIFKAKEAL
TEVSREFDIEVIFFDGRGGPPARGGGKTHQFYASLGPTIEDKEIQLTVQGQTISSNFGTQ
NSAQYNLEQLLSSGIKNDIFTKDQLNDDNRKLIEDMAETSYKTYVDFKNHPQFLPYLEKM
STLKYYAKTNIGSRPSKRSSSATLDFSALRAIPFVGSWSQLKQNVPGFFGVGTALKKYED
AGRFDEIVEFYNASDFFKTLLENSMMSLTKSFFELTAYMADDAEFGEFWKLIFEEYKTTK
RLLLKLTGHKVLMENFPIGKASIEIREQIVLPLLTIQQFALKQIQELQSSDENAAKIEVY
EKMVMRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggattatctaaactttctcgttttaatgaaaatgtgttgtctaaatatcaaatt
tacaacagtatttttatgaccttacctttcgacaccattagcaatactggtgtgttacta
cccttatttcataaattgtgtgaaaaaggatttcaagaaggaaaaaatccgacagaaatt
gtaaataccttctttagtaagtaccaagaaaatcctacagaaaaagagaaaacagattta
ttatttcgttttattcagtacatagagcgccaagtagttttgtttgatgctattgaagac
gctgcttttcccgtggtaaataatatggacggaattggcacgcttagaaactctaaagaa
actgcaattttaagtgataaaaaagaagctttaaaagcccatttagaagattttaaagtt
cgtgtggttttaacagcgcacccaacacaattttaccctggaagtgttttaggtattatt
acagatttagatcaagcgattcagaatgatgatttattactgataaaaaaattgttagct
caattaggaaaaacgccgttttataaaaaagcgaaaccgtctccttatgatgaagcgatc
agcttaatttggtatttagaaaatgtattttatcattctatcagtaaaatatataactac
attcaaaacaatatttatgatggaaatcctatggataatgaaattatagaccttggtttt
tggcctggtggagacagagatggaaatccgtttgttaccacacaaattacattagatgtt
gcagaaaaactacgtcaatctattttaagaagctactacagagatgtaaaaaggttaaag
agacgttttacttttgatggggttcaagaaatattagcaagagtagaaaaaagactttac
aaacacgttgttagaagttatagtaaagtcaacttttctcaaaaaatattattagaagaa
ctctctaatgctagacagattgtagcagataaacaccaatctttgtttatcgaagagtta
gatgattttataaataaagtaagaattttcggttttcactttgcaacattagatattaga
caagacagtagagtgcatcaccaagcatttacacaaattgtaaaagacttgcatactatt
ggtgacagtacttttcctaaaaattacgaacatttatctgaagaagaacaaatagaaatt
ttagcggccgcaaaaggaagcatcgatcctaaaaccttaacagacgacacttctgtaagc
accatagaatctatgtatgctttgaaacagattcagaaaagaaacggagaacgtggtgca
aaccgttacattattagcaacaaccaaacggcgttaaatgtaatggaaacttttgcgatg
ttgaatctatgtggctttgaaaatgggttaccggtagatgtaattccgctttttgaaact
gtagaagatttgcagaatgcagaagaagtaatgagaaccttgtattcaaatagaacgtac
agatatcatttagaaaaaagaaaaaacaaacaaaccattatgctaggtttctctgacggg
acaaaagatggtggctatttaatggcaaactggggaatttttaaagcaaaagaggcgctt
acagaagtttctagagaatttgatattgaagttattttctttgacggacgtggtggacca
cctgctcgtggaggtggaaaaacacaccaattttatgcttctttaggacctacaattgaa
gacaaagaaattcaattaactgtgcaaggacaaaccattagctctaacttcggaacacaa
aattctgctcaatataatttagaacaattattaagttctggtattaagaatgatattttc
acaaaagatcaattaaatgatgacaatagaaaattgattgaagatatggctgaaacaagc
tataaaacttatgttgattttaaaaatcatccgcagtttttaccgtatttagaaaaaatg
agtacgttaaaatattatgctaaaacaaatattggtagcagaccaagtaagcgttctagt
tctgctacgttagatttttctgccttaagagccatcccttttgtaggaagttggagccaa
ttaaaacaaaacgttcctggtttctttggtgtaggaactgcacttaaaaaatatgaagat
gctggtcggtttgatgaaattgtagaattttacaacgcttcagatttctttaaaacgctg
ctagaaaatagtatgatgagtttgaccaaatctttctttgaattgactgcatacatggca
gatgatgctgagtttggtgaattttggaaactgattttcgaagaatacaaaacgactaag
agattacttttaaaacttacaggacataaagtattaatggaaaacttccctattggaaaa
gcttccattgaaattagagagcaaattgtcttacctcttttaaccattcagcaatttgct
ttaaaacaaattcaagaattacaatcttcagacgaaaatgcagctaagattgaagtttat
gaaaaaatggtgatgcgttctttattcggtaatattaatgcaagtagaaactctgcttaa

DBGET integrated database retrieval system