KEGG   Polaribacter vadi: LPB03_05245Help
Entry
LPB03_05245       CDS       T04504                                 

Definition
(GenBank) potassium channel protein
  KO
K10716  voltage-gated potassium channel
Organism
pob  Polaribacter vadi
Brite
KEGG Orthology (KO) [BR:pob00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pob02000]
    LPB03_05245
Transporters [BR:pob02000]
 Other transporters
  Pores ion channels [TC:1]
   LPB03_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N Ion_trans_2 TrkA_C Ion_trans NAD_binding_7 TT_ORF1
Motif
Other DBs
NCBI-ProteinID: AOW16904
UniProt: A0A1B8TX50
LinkDB All DBs
Position
complement(1181405..1182403)
Genome map
AA seq 332 aa AA seqDB search
MRNFDSKIYTTLLLVASTIAVGTIGYMWLSHYTFIDAVYMTVITVTTVGFGELRPFSPEE
KVFTIFLILTSITIFGYAISAFSEYLVSGKLFDHFKHRNVEKQINRLTGHTIVCGFGRNG
KQAILKLTNYNKKIVVIENDKEIIDLLDAEEILNVQGDATTDEVLLRAGITNAANLITTL
PSDADNLFVVLSARQLNKDFKIISRASNESSYSKLKIAGADNVIMPDKLGGNHMASLVTT
PDVIEFVDRLTIEGETTANLEEIDVDTLPAKYLGKTILDLDLRRQTGCTVIGFRNPDKDY
IINPEANSKLIQGSHLIVLGRPEQIIKLRELF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcgactctaaaatatatacaaccttacttttagttgcatctactattgca
gtaggtacaattggctatatgtggttgtctcattatacttttatagatgctgtttatatg
actgtaattacagttactacagttggttttggagagttaagacctttttcgcccgaagaa
aaagtatttacaatttttttaattttaacgagtattactatttttggatatgcaatttct
gccttttcagaatatttagtaagtggaaaactttttgatcattttaaacatagaaacgtg
gaaaaacaaattaatagattaacaggacatactattgtttgtggttttgggagaaatgga
aaacaagcaattttaaaattaaccaactacaataaaaaaattgtggtaatcgaaaatgat
aaagaaattatagatttattagatgcagaagaaattttaaatgtgcaaggagatgcaact
acagatgaggttttgttaagagcaggaattacaaatgcagcaaatttaataacaacttta
ccttcagacgcagataatttatttgtggttttaagtgcgagacaattaaataaagatttt
aaaattataagcagagcaagtaacgaaagttcttacagtaaattaaaaatagcgggtgca
gataatgtaattatgccagataaattaggtggaaatcatatggcttctttagtgacaact
ccagatgttattgagtttgtggacagattaacaattgaaggtgaaaccacagcaaattta
gaagaaattgatgttgacacacttcctgcaaaatacttaggaaaaacaatcttagattta
gatttaagaagacaaacaggctgtacagttatcggttttagaaatcctgataaagattac
attataaatcctgaagcaaatagtaaattaatacaaggttctcatttaattgttttagga
aggccagaacaaatcattaaattaagagaattgttttag

DBGET integrated database retrieval system