KEGG   Polaribacter vadi: LPB03_06745Help
Entry
LPB03_06745       CDS       T04504                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
pob  Polaribacter vadi
Pathway
pob00030  Pentose phosphate pathway
pob01100  Metabolic pathways
pob01110  Biosynthesis of secondary metabolites
pob01120  Microbial metabolism in diverse environments
pob01130  Biosynthesis of antibiotics
pob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LPB03_06745
Enzymes [BR:pob01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     LPB03_06745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SBP56 Chordopox_G3 SGL PBECR3
Motif
Other DBs
NCBI-ProteinID: AOW17178
UniProt: A0A1B8TZB8
LinkDB All DBs
Position
complement(1509160..1510263)
Genome map
AA seq 367 aa AA seqDB search
MKKISMFIVITLFFSCSMSKVKEKTGSNFYVGTYTNGESEGIYKYQLNAAGKLKQIGLVA
KTDNPSYLAKTKDNKTLLAVDETNENGTGYVNSFRIEKDSLVFVSKSKSGGAHPCFVSIN
DKNQVLVANYSGGNVGFLEIDDQNGLTNLLAVQQHVGNDINPKQQTPHAHFAKYHPRNNE
IISVDLGTNQLWFSTFDTQKKELAFTNQKTLNMNVGAGPRHFTFHPNNKWMYVVNELNST
VSLVKEKENLYTVDQTIAMLPKDFKKYSKAADIHISKDGQFVYASNRGHESIVIYKVNPE
NGTLNLVGFQNVKGKHPRNFSLSPDDNFLLVANKDSNNIVCFKRDSKTGKLSFVDEVFVP
NPVCVLF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatcaatgtttattgtaatcacgcttttttttagttgttctatgtctaaa
gttaaagagaaaacaggatccaatttttacgttggcacgtatacgaatggagaaagtgaa
ggtatttataagtatcagttaaatgcagcaggaaaactgaagcaaattggtttggttgca
aaaacagataacccttcttatttggcaaaaactaaagataacaaaacattattggcagta
gatgagaccaacgaaaacggaacaggttatgtgaattcttttagaatagaaaaagatagt
ttggtttttgtgagcaaatcgaaatctggaggagcacatccttgttttgtttctataaat
gataaaaatcaagtgttggttgccaattattcaggtggaaatgttggttttttagaaatt
gatgatcaaaatggattgacaaatttattagctgttcagcaacatgtagggaatgatatc
aatccaaaacagcaaacaccacacgcacattttgcgaaatatcacccaagaaataacgaa
attatttctgttgatttaggaaccaatcagctttggttttcaacttttgatacacaaaaa
aaagagttagcttttaccaatcaaaaaacgctgaatatgaatgttggtgcagggcctaga
cattttacttttcacccaaataataaatggatgtatgttgtaaatgagttgaatagcaca
gtttctttggtaaaagaaaaagagaatttatatacggttgaccaaacaatagcaatgttg
ccaaaagattttaagaaatacagcaaagctgctgatattcatatttctaaagatggccaa
tttgtatatgcttccaatcgtggacacgaatcgatagtaatttataaagtaaatccagaa
aatggaactttaaatttggttggttttcaaaatgtgaaaggcaaacatccacgtaatttt
tctttatctccagatgacaattttctattagttgccaataaagattctaacaatattgtt
tgttttaaaagagattctaaaacaggtaaattaagttttgtggatgaagtttttgtgcca
aatcctgtttgtgttttgttttga

DBGET integrated database retrieval system