KEGG   Polaribacter vadi: LPB03_10325Help
Entry
LPB03_10325       CDS       T04504                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pob  Polaribacter vadi
Pathway
pob00630  Glyoxylate and dicarboxylate metabolism
pob01100  Metabolic pathways
pob01120  Microbial metabolism in diverse environments
pob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LPB03_10325
Enzymes [BR:pob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LPB03_10325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AOW17826
UniProt: A0A1B8TSH5
LinkDB All DBs
Position
complement(2365214..2366458)
Genome map
AA seq 414 aa AA seqDB search
MERVFAEYLIETPYDVGQAAAVLAGEQSSGTFVAVPGETEELKQRFAARVEHIELLDLVN
EPSIPGGKISGKKYQKAKVKVSWSIENFGYNLPVLISTLQGNLYEITQFTGLKLMDLELP
DSFKNHYKGPQFGIKGSKASCGIGCERPMIGTIIKPSVGMFPEETATLVQTLIDAGIDFI
KDDELMGSTANSPFNERVKAIMKVIRNNEQRTGKKVMYAFNISDEIDVMQRKYDLILQEK
GSCAMISVNSVGLAGTKKICDNGQLVIHGHRNGWGMLNRHPMLGIEFPAYQKLQRLAGVD
QLHVNGIQNKFWESDDSVVTSIKSCLKSFLGGNEILPVVSSGQWGGQAFETYKRTQTTDL
LYMAGGGILAHPMGPKAGVNALQQAWEGAVDGSSIEETANKHKEFAASVKKFSK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagtttttgcagaatatcttatagaaacgccttacgatgtaggacaagctgca
gcagttttggctggcgaacaatcttcgggaacatttgttgctgtgcctggtgaaacagaa
gaactaaaacaacgttttgcggcaagagttgaacatattgaattattggacttagtcaat
gaaccttcaattccaggtggcaagatttctggtaaaaaatatcaaaaagcaaaagttaaa
gtaagttggtccattgaaaatttcggttataatttacctgttttgataagtacattacag
ggaaatttatatgaaattactcaatttacaggcttgaaattaatggatttagaactgcct
gattcttttaaaaatcattataaagggcctcaatttggcattaaaggttccaaagcatct
tgtggtataggttgtgaaagacccatgattggaaccatcataaaaccaagtgtaggcatg
tttccagaagaaactgcaactttggtgcaaacattaattgatgcaggtatagattttata
aaagatgatgaattaatggggtctacagctaattccccttttaatgagcgcgtaaaagcg
attatgaaagtcatcagaaataacgagcagagaacaggaaaaaaggtgatgtatgcattt
aatatttcagatgaaatagatgtaatgcaacgaaagtatgatttaatacttcaagagaaa
ggcagttgtgcaatgattagcgttaatagtgttggtttagcaggtacaaagaaaatttgt
gataatggtcagttagttattcatggtcatagaaatggctggggtatgttaaacaggcat
cctatgttgggcattgaatttcctgcatatcaaaaacttcagcgattggcaggtgtcgat
caattacatgttaacggtattcaaaataaattttgggaatctgatgattctgtggtaact
tccattaaatcatgtttaaaatcatttttaggcgggaatgaaattttacctgtggtatct
tctggtcaatggggtggacaagcttttgaaacctacaaaagaacgcaaactactgacttg
ttgtacatggcaggaggtggcattttagcacatccaatgggaccaaaagcaggtgtaaat
gcattgcaacaagcttgggaaggtgctgtagatggttcgtcaattgaagaaacagccaac
aaacacaaagaatttgcggcatccgttaagaaattttctaaataa

DBGET integrated database retrieval system