KEGG   Polaribacter vadi: LPB03_10335Help
Entry
LPB03_10335       CDS       T04504                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pob  Polaribacter vadi
Pathway
pob00052  Galactose metabolism
pob00511  Other glycan degradation
pob00600  Sphingolipid metabolism
pob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pob00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LPB03_10335
  Lipid metabolism
   00600 Sphingolipid metabolism
    LPB03_10335
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LPB03_10335
Enzymes [BR:pob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LPB03_10335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AOW17828
UniProt: A0A1B8TST2
LinkDB All DBs
Position
complement(2368436..2370859)
Genome map
AA seq 807 aa AA seqDB search
MKHIKIIYILLITIFFVGCGAEENNVRIVKDFNFDWKFNLGDVPEAKVTSFNDENWRTLN
LPHDWSVEGEFSIDNPAKPEGGALPTGIAWYRKTFTLPIEYDNKSISIEFDGIYRKSEVW
INGQYLGIRPNGYVSFAYDLTDYLKYGDKENVITVKVDNSEQPNSRWYSGSGIYRNVRLV
VAEKLHIAHWGTYVTTPEISKEKALVNFEITLQNDANLDKKYKVVSSIVNNEEFEVAQAT
SEESINKNSVKKQIQNFEILNPNLWDTKNPYLYKIKTKVFEGSKLVDNYTTPLGIRYFNF
DAKNGFSLNDVPMKIHGVCLHHDNGALGAVANYEAIKRKLTIMKDMGVNAIRVSHNPSSL
ELLQLCDEMGLIVQVEAFDSWKKRKVKYDYNLYWDEWHKKDLEDFVKRDRNFPSVMMWSI
GNEIREQFDSTGVAITKELVSIVKSLDKTRPVTCALTENIPEKNFIYQSGALDLLGFNYK
HKDFYDFPEKFKGEKILASESVSAIETRGHYDMPSDTIKRWPPAHNAPFDGNDDYTASAY
DQISAYWGATHEENWKTVKSLNFIAGTFIWTGFDYLGEPIPYPYPARSSYFGIVDLAGLP
KDVYYMYQSEWTKKDVLHVFPHWNWEEGQEVDVWAYYNNADEVELFLNGKSLGSKSKQND
DLHIIWRVKYEPGTIKAISRKDGKVVLEKEIHTAGTPSKIELIANKESIKNNHYDLVYVM
VNIKDADGNLVPKANNSLDFEVTGGGSIVGVDNGYQANLSSFKASKIKAFNGKCVVIIQS
NGKSETIRLKASSNIGNTEKLIKIKTD
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatataaaaattatatacatattactaatcactattttttttgttggatgtggt
gccgaagaaaataacgttagaattgttaaagattttaattttgattggaaattcaatttg
ggtgatgttcctgaagctaaagttacttcttttaatgatgaaaattggcgaactctaaat
ttaccacatgattggagtgttgaaggtgaatttagtattgataatcctgctaaaccagaa
ggaggtgctttgccaacaggaattgcttggtatagaaaaacgttcacacttccaattgaa
tatgataataaatcaatttcaatagaatttgatggtatttaccgaaaaagcgaagtatgg
ataaacggacaatatttaggtattcgtccaaatggttatgtatcatttgcctacgattta
actgattatttgaaatatggtgataaagaaaacgtcattactgttaaggttgataattct
gaacaaccaaactctagatggtattctggttctggcatttacagaaatgtacgtttggtg
gttgctgaaaaacttcatatagcacattggggaacatacgttactacaccagaaatttca
aaagaaaaagctttggtaaacttcgagataacgcttcaaaatgatgcaaatttagataaa
aaatacaaagttgttagctcaattgtaaataacgaagaatttgaggttgcacaagctact
tcagaagaaagtatcaataaaaatagtgtaaaaaaacagatacaaaattttgagatatta
aaccctaatttgtgggataccaagaatccttatctctataaaattaagactaaggttttt
gaaggttctaagttggtagataattacacaacacctttaggaattcgttattttaatttt
gatgcgaaaaatggtttttctctaaacgatgttccaatgaagattcatggcgtttgtttg
catcatgataatggtgctttaggtgcagttgcaaattatgaggcaattaagcgtaaactc
accataatgaaagatatgggtgtaaatgctattcgcgtttcacacaatccatcttcatta
gagttattacaattatgtgatgaaatggggttgatagtacaggttgaagcttttgattcc
tggaaaaagagaaaagtaaaatatgattataacctatactgggatgaatggcataaaaaa
gatttagaggattttgtaaaacgggatagaaattttccatcagttatgatgtggagtatt
ggaaacgaaatccgtgaacagtttgatagcacaggagtcgctattactaaagagcttgta
agtattgtaaaatctttagataaaaccagacctgtaacttgtgctttaacagaaaacatc
ccagagaaaaattttatttatcaatctggagcgttagatttattaggattcaattataaa
cataaagatttttatgattttccagagaaatttaaaggtgaaaaaatactagcgtcagaa
agtgtttcggctatagaaacacgcggacattatgatatgccttccgatacaataaaaaga
tggccaccagcgcataacgcaccttttgatgggaatgatgattatacagcatctgcttat
gatcaaatatctgcgtattggggagcaacacacgaagaaaactggaaaacagtaaagtct
ttaaactttattgcaggcacttttatttggacaggttttgattatttaggagaaccaatt
ccatatccatatcctgcaagaagttcgtattttgggattgttgatttggcaggtttacca
aaagatgtgtattatatgtaccaaagcgaatggacaaaaaaggatgttttacacgttttt
ccacattggaattgggaagaaggtcaagaagtggatgtttgggcgtattacaacaatgca
gatgaagtggaattgtttttaaatggaaaatctttaggaagtaaatcaaaacaaaatgat
gatttacatattatatggcgtgttaaatacgagccaggaactattaaagcaatttctaga
aaagatgggaaagtggttctagaaaaggaaatacacactgcaggcactccatcaaaaata
gaattaattgctaataaagaaagtattaaaaataatcattacgatttggtttatgtgatg
gtaaatattaaagatgctgatggtaatttagtgccaaaagcaaataattcacttgatttt
gaagttactggtggaggttcaattgtaggtgttgataatggatatcaagcaaatttatca
tcattcaaagcatcaaaaataaaagcttttaatggaaagtgtgttgtaattattcaatca
aacggaaagtctgaaacgataaggttaaaagcttcgtccaatattggaaatacagaaaaa
ttaataaaaattaagacagattaa

DBGET integrated database retrieval system