KEGG   Polaribacter vadi: LPB03_12905Help
Entry
LPB03_12905       CDS       T04504                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pob  Polaribacter vadi
Pathway
pob00240  Pyrimidine metabolism
pob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pob00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPB03_12905
Enzymes [BR:pob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LPB03_12905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AOW18292
UniProt: A0A1B8TUA1
LinkDB All DBs
Position
complement(2978089..2978748)
Genome map
AA seq 219 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQSVEIFKPAVDTRYDDEE
VVSHNDNRIRSTPVPVSSNIRLLANNVDVVGIDEAQFFDDEIVAVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTHTGNLAHYSFRKAQNDKLVMLGETQEYEP
LSRAAYFKANKKKQEEIALTKQNIESKIIDSELGSEIQK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcatacagaacaatttggttggatagaagtcatttgt
ggttctatgttttctggaaaaacggaagaattaatcaggcgtttaaagcgtgcacaattt
gctaaacaaagtgtagaaatttttaaacctgctgtagatacacgttatgatgatgaggaa
gttgtgtctcataatgataatagaattcgctcaactcctgtgccagtttcatctaatatt
cgtcttttagcaaacaatgtagatgttgttggtattgatgaagcgcaattttttgatgat
gaaattgtagctgtttgtaatgatttagccaacagaggaattcgtgtaattgttgctgga
ttagatatggattttaaaggaaatccttttggacccatgccagctttaatggcaactgca
gaatatgttaccaaagtgcatgcagtttgtacgcatacaggtaatttagctcattatagt
tttagaaaagcgcaaaatgataagttagtaatgttgggagaaactcaagaatatgaacct
ttaagcagagcagcgtattttaaagcgaataaaaaaaagcaagaagaaattgctttgaca
aaacaaaatattgaatctaaaataatagattctgaattaggttcagagattcagaaataa

DBGET integrated database retrieval system