KEGG   Polaribacter vadi: LPB03_15705Help
Entry
LPB03_15705       CDS       T04504                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pob  Polaribacter vadi
Brite
Enzymes [BR:pob01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LPB03_15705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5 Antig_Caf1
Motif
Other DBs
NCBI-ProteinID: AOW18808
UniProt: A0A1B8TQ79
LinkDB All DBs
Position
complement(3625353..3625889)
Genome map
AA seq 178 aa AA seqDB search
MKNLKLNTLKTGILVCCLALFSCTENADKTAVANLSPKSGSNVTGTLTFTESNGKVMLKA
TIKGLTPGGTQAIHIHENGDCSSDDGTSAGGHWNPSGHDHGKWKEGDFHSGDIGNLEADE
NGVATIEKESDFWAINGDDETKNIVGKGIIVHAGVDDFKSQPSGAAGARVACGVIEVQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaaactgaatactttaaaaacaggaatcttagtttgctgtttagcatta
ttctcttgtacagaaaatgcagacaaaacagcagtcgctaatttatctccaaaaagcgga
agtaatgttactggaaccttaacttttacagaaagtaatggaaaagtaatgttgaaagca
accattaaaggtttaacacctggaggaacgcaagccattcatattcacgaaaatggagat
tgctcttctgatgatggaacctctgctggaggacactggaatccatcaggacatgatcat
ggaaaatggaaagaaggagatttccatagtggagatattggaaacttagaagcagatgaa
aatggtgttgcaaccatagaaaaagaaagcgatttctgggctataaatggcgatgatgaa
actaaaaacattgttggcaaaggaattattgtacatgcaggagtagatgattttaaatct
caaccttctggagcagctggagcaagagttgcttgtggagttattgaagtacagtaa

DBGET integrated database retrieval system