KEGG   Paenibacillus odorifer: PODO_03065Help
Entry
PODO_03065        CDS       T03326                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pod  Paenibacillus odorifer
Brite
Enzymes [BR:pod01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PODO_03065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AIQ72335
UniProt: A0A1R0WVD7
LinkDB All DBs
Position
complement(680817..681995)
Genome map
AA seq 392 aa AA seqDB search
MLYVYGPMLPVRILEEIVFWKTQEKEHTEVIKAIVPNLEEPYVKLLDEWAVVFGATEMAA
QQLLNSALSASPPSQAELTAETEKLLHISCTQSQEFVRQLFAIMESSAAVKAVPLATTVI
LHIIRESEYFLAVLHTLSSPGQLTQIMRDYTAADNVVRTEEDNGTRNEGLIPSTDTILDI
REMSAVPIGGHTLPPLPYAYNALEPYIDEKTMRIHHDKHHQSYVDGLNKAENKLAEARKK
GDFDLVKHWERELAFNGAGHYLHTIFWNVMSPQGGGRPTGALLEAIEQSFGSYDNFKKQF
TEAANKVEGGGWAILVWSPRSHRLEILTAEKHQNLSQWDVVPLLALDVWEHAYYLKHQNN
RADYIEDWWKVVNWPYVSERYAAASKLAWKPF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttatatgtatacgggccgatgctgccagtacgtattttagaagaaatcgtattctgg
aaaacacaagagaaagagcataccgaggttatcaaagcaatcgtacctaacctggaggaa
ccctatgttaaactgctggatgaatgggcggtggtcttcggtgccacagagatggccgct
caacagttattgaattctgccctctctgcttctccaccaagtcaggctgaactcactgcg
gaaacagaaaagctgctgcacatctcctgtacccaatcccaagaatttgttcggcagctt
tttgccatcatggaaagcagcgcagccgtcaaagccgtcccccttgcaaccactgtgatc
ctgcatattattcgcgaatcagagtatttccttgccgtactgcacactctgagctcgccc
ggacagctcacgcaaattatgagagattatacagcagccgacaatgtcgtaagaacagaa
gaggacaatggcacgcggaatgagggacttattccttctacagatactatccttgatatt
cgtgaaatgagtgctgtgccaattggcgggcatacactgcctccattgccttatgcttat
aatgcgctggaaccatacatcgatgagaaaaccatgcggattcatcatgataaacaccat
caaagttatgtagatggactaaacaaagcggagaacaagctagccgaggctcgcaagaaa
ggagatttcgatcttgttaagcattgggaacgggagctagcctttaatggggctggccac
tatctccatacaatcttctggaacgtaatgtcacctcaaggtggcgggcgtccaactgga
gccttactggaagccattgaacaaagcttcggcagctatgacaacttcaagaaacagttc
acagaagctgcgaataaggttgaaggtggcggctgggctattctcgtctggagtccacgc
agtcatagactggagattttgactgcggagaaacatcagaacctgtcacaatgggacgtt
gttccgttactggctctggatgtatgggagcatgcctattaccttaaacatcagaataat
cgggccgattatattgaggattggtggaaggtcgttaactggccttacgtctcagaacgt
tatgctgctgccagtaaactggcctggaagcccttttga

DBGET integrated database retrieval system