KEGG   Paenibacillus odorifer: PODO_05465Help
Entry
PODO_05465        CDS       T03326                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pod  Paenibacillus odorifer
Pathway
pod00473  D-Alanine metabolism
pod01100  Metabolic pathways
pod01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pod00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PODO_05465
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PODO_05465
Enzymes [BR:pod01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PODO_05465
Peptidoglycan biosynthesis and degradation proteins [BR:pod01011]
 Precursor biosynthesis
  Racemase
   PODO_05465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C PAAR_motif Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AIQ72752
UniProt: A0A1R0X9E6
LinkDB All DBs
Position
1242182..1243363
Genome map
AA seq 393 aa AA seqDB search
MQASYRPTVAEINLDDLRANYEAFRRYLPAETKFMGCVKGNAYGHGAVEVTRELERLGAD
YVSVAFLDEALELRQAGILIPILVLGYTSPEGIAVAWENHVTVTLFTPEVLEAIRQLPID
PEHRLKVHIKIDSGMGRLGLLPADAPAFISEVQSVAQAELEGMFTHFAKADEQDKSYTLE
QHRRFMSVAETLREQNIQIPIIHTGNSATAIDSPYLSSNMVRVGISLYGFYPSTEVNRQL
VELRPVLTLKTQVVYVKSLPADWGVSYGTRYITESEEIIATLPVGYADGYSRMLTGKAEV
LIRGRRVPVVGTICMDQCMVSLKSFAAEAEQIKAGEEVVLIGRQADVMITADELALQLGT
IHYEVICMLAHRVPRVYISEGTLPKLVNALLTN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcaagctatcgaccgacagtagccgaaattaatctggatgatttgcgtgccaat
tacgaagcctttcgccgctacttgccggcagagacaaagtttatgggatgcgtcaaagga
aatgcgtacggccatggagcagtggaagtgacacgggagctggaaagactcggagcagat
tatgttagtgtggcttttttggatgaagcattggagctgcgtcaggcgggaatactgatt
cctatactggtgcttggctacacttccccagaaggaatagccgttgcctgggagaaccat
gtaactgtaacactgttcacaccggaggtactggaggctataagacagcttcctatagat
ccggaacatcggctaaaggtgcatatcaagattgatagcgggatgggacgactgggtctt
ttaccagctgacgcacctgcatttatctctgaagtgcagtctgttgcgcaggcggagctg
gagggtatgtttacccattttgccaaggcagacgaacaagacaaaagctatacactggaa
cagcatcgacggttcatgagcgtggcggaaacgctgcgggagcagaacattcagatcccg
atcatacatacgggcaatagcgctacggccattgattcaccttatttatccagcaacatg
gtgcgtgtaggcatcagcttgtacggattttatccctccacagaggtgaaccgtcaactg
gtagaactacgtccggtattgacgctgaagacgcaggttgtatatgtcaaaagcctgcct
gccgattggggcgtcagttacggcactaggtacatcacagagagcgaggagattattgca
acgctacctgtggggtacgcagatggatattcccgcatgctaactggcaaagcggaggtg
ctaatacgtggacgccgcgttcctgtcgtcggaacaatctgcatggatcagtgtatggta
tcactcaaatctttcgctgcagaagcggaacaaattaaagcaggcgaagaagttgttctc
atcggccgtcaagctgacgtgatgatcacggcagacgagttggctctccagcttggaaca
attcactacgaggttatctgcatgttggctcatcgggtgccacgcgtttatataagtgaa
ggcacacttcctaaattagtaaatgctctactcacaaactga

DBGET integrated database retrieval system