KEGG   Paenibacillus odorifer: PODO_06080
Entry
PODO_06080        CDS       T03326                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pod  Paenibacillus odorifer
Pathway
pod00071  Fatty acid degradation
pod00072  Synthesis and degradation of ketone bodies
pod00280  Valine, leucine and isoleucine degradation
pod00310  Lysine degradation
pod00362  Benzoate degradation
pod00380  Tryptophan metabolism
pod00620  Pyruvate metabolism
pod00630  Glyoxylate and dicarboxylate metabolism
pod00640  Propanoate metabolism
pod00650  Butanoate metabolism
pod00900  Terpenoid backbone biosynthesis
pod01100  Metabolic pathways
pod01110  Biosynthesis of secondary metabolites
pod01120  Microbial metabolism in diverse environments
pod01200  Carbon metabolism
pod01212  Fatty acid metabolism
pod02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PODO_06080
   00630 Glyoxylate and dicarboxylate metabolism
    PODO_06080
   00640 Propanoate metabolism
    PODO_06080
   00650 Butanoate metabolism
    PODO_06080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PODO_06080
   00072 Synthesis and degradation of ketone bodies
    PODO_06080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PODO_06080
   00310 Lysine degradation
    PODO_06080
   00380 Tryptophan metabolism
    PODO_06080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PODO_06080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PODO_06080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PODO_06080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pod04147]
    PODO_06080
Enzymes [BR:pod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PODO_06080
Exosome [BR:pod04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PODO_06080
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: AIQ72856
LinkDB
Position
1366918..1368069
AA seq 383 aa
MIEAVIVMAKRTPIGRMGGLLSTLEPEALLAPLIQHIVAETNLPKELIDDVIIGNVVGPG
GNIARVAALEAGLPVSVPGVTVDRQCGSGLEAINIAARLIQSGAGEIYLAGGVESTSRAP
WKMAKPQTLMGVPQLYTRAHFTPSSYGDPDMGIAAENVARKYGISREEQDQYALKSHQRA
VHAQQSDRFQQEIVPLQVEGQWVNTDECPRANTSLDKLQKLPPIFEERGTVTAGNACPIN
DGAALLLMMSREKCQQLKLKPILRVVDAQAAGVDPNYLGIGPVPAVQKVLKRQKLTVADL
DIVEFNEAFASQVLASLNELQIPQEKVNLGGGALAIGHPYGASGAILMTRLCAEMQNAPY
QRGLATLGIGGGIGLATLVEVIE
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgatagaagcagtaattgtcatggcaaaacgtacaccgattggcagaatgggtggctta
ttaagtacacttgagccggaggcattactggcgccacttattcagcatattgtagccgaa
acgaacttgcctaaagaactgatcgatgatgtcattattgggaatgttgtgggcccagga
ggtaatattgcccgggtagctgcgcttgaagcggggctgcctgtttcggttccgggcgtc
accgtggatcgtcagtgcggatctgggctagaggcaattaatatagcagcaagactgatt
caaagcggcgctggtgagatttatttagcgggtggtgtcgaaagtacgagccgtgctcca
tggaaaatggctaaaccacagaccttaatgggggttccgcagctatatacccgtgcacat
tttacgcctagctcttacggtgatccggatatgggaattgctgcagagaatgtagctcgg
aaatacgggatttctcgagaagagcaggatcaatatgccttgaaaagccatcaaagggcg
gttcatgctcagcaaagtgaccggtttcagcaggagatagtacctcttcaggtagagggg
cagtgggtgaacaccgacgaatgtcctcgggctaatacgagtctggacaagctgcaaaag
ctgccgccaatttttgaagaaaggggtaccgtcactgctggaaatgcctgtcctattaat
gatggcgcagcgcttctattaatgatgtctcgggagaaatgccagcagcttaagctgaag
cctattttacgggtcgtggatgcgcaagctgcgggtgtagatccgaactatttagggata
gggcctgtaccagctgtgcaaaaggtgttaaaacgccaaaagcttaccgttgccgattta
gatatcgtagagtttaacgaggcttttgcttcacaagtattggcttcactgaatgagctt
caaattccacaggaaaaggtcaatcttggcgggggggcattagcaataggccatccatac
ggagcttccggggctattttaatgactcggttatgtgctgaaatgcaaaatgctccttac
caacgagggcttgctactctgggaatcggcggcgggataggtctggcaacactcgtggag
gttatagaatga

DBGET integrated database retrieval system