KEGG   Paenibacillus odorifer: PODO_06090
Entry
PODO_06090        CDS       T03326                                 

Definition
(GenBank) hypothetical protein
  KO
K17865  3-hydroxybutyryl-CoA dehydratase [EC:4.2.1.55]
Organism
pod  Paenibacillus odorifer
Pathway
pod00630  Glyoxylate and dicarboxylate metabolism
pod00650  Butanoate metabolism
pod01100  Metabolic pathways
pod01120  Microbial metabolism in diverse environments
pod01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PODO_06090
   00650 Butanoate metabolism
    PODO_06090
Enzymes [BR:pod01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.55  3-hydroxybutyryl-CoA dehydratase
     PODO_06090
SSDB
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Other DBs
NCBI-ProteinID: AIQ72858
LinkDB
Position
1368436..1368783
AA seq 115 aa
MIMIKKCITAEAIRQYAAASQDLAPIHLDAEAAAKAGLERPIAHGMYLMGLAQSLYIAEH
PTQWITQYDMKFHKPIEVDSVVIFDFAADDCFVKVILTTEAGDVIAAGAFAVKEV
NT seq 348 nt   +upstreamnt  +downstreamnt
atgatcatgataaaaaagtgcataactgctgaggctatccggcaatatgcagctgcttcc
caagatttggcgcctatacatctagatgcagaggccgcagctaaggctggtttggagcga
cccatcgcacatgggatgtatcttatgggattagctcaatccttgtatattgctgagcac
cctacacagtggatcactcaatatgatatgaaatttcataagcctatagaggtcgatagt
gtcgtgatttttgattttgcagctgacgactgctttgtgaaagtgatccttacaacagaa
gctggcgatgttattgctgcgggagcttttgcagtgaaagaggtgtag

DBGET integrated database retrieval system