KEGG   Paenibacillus odorifer: PODO_06655Help
Entry
PODO_06655        CDS       T03326                                 

Definition
(GenBank) phosphohydrolase
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
pod  Paenibacillus odorifer
Brite
KEGG Orthology (KO) [BR:pod00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pod03019]
    PODO_06655
Enzymes [BR:pod01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     PODO_06655
Messenger RNA biogenesis [BR:pod03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     PODO_06655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: AIQ72958
UniProt: A0A1R0XN90
LinkDB All DBs
Position
1488950..1489906
Genome map
AA seq 318 aa AA seqDB search
MTQIKQLAPQDEFVGFYLLRELAIKQTNGTPPKDYFDIVLGDSTGQLSAKYWDASTTDKE
TFFPMALVKVRGIAHTYREKLQIKITKIRLVNDEDGVALTDFIRSAPIRPVDLIHTIKGV
MASISDPEIASIVSFCVGKVEEKLMHYPAAKTHHHAYFAGLAYHMVRMLEIGDFLCKQRP
FLNPDLMKAGIILHDIAKPEEMVSQLGIVSEYSVQGKLIGHISMASNWITEAAIRLDIDL
NSEKVMALQHLVLSHHNLGEWGSPVQPQTAEAVALHHIDAMDAKLQMVEDALDTTPETEE
WTPFIRGLENKAVYRLKI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaattaaacagctcgctccacaagatgaatttgttggcttttatcttttaaga
gagctggcaattaaacaaacgaacggcactcctccaaaagattattttgacatcgtcctg
ggggattccactggacaattatccgcgaaatattgggatgccagcacaactgataaagaa
actttttttcctatggcgcttgtgaaggtacgcgggattgctcatacttatcgtgagaaa
ttacaaataaaaattactaaaatcaggttggttaacgatgaggatggcgttgcacttacg
gatttcatccgttctgccccaattcgtccagtagaccttattcatacgattaaaggggtt
atggcaagtatttcggatccggaaattgcttcaattgtctctttttgtgtgggtaaagtg
gaagagaaattgatgcattatccggcagccaaaacacatcatcatgcttattttgccgga
cttgcttatcatatggtgcgtatgctggaaatcggtgattttctgtgcaagcagcgtccg
ttcttgaatccagatctaatgaaggccgggatcattctgcatgatatcgcgaagccggag
gagatggtctcccagcttgggattgtctcggaatatagcgttcagggcaaattaattggc
catatctcgatggcgtctaattggatcacggaagcggctatccgcttagatattgatttg
aattcggaaaaggttatggcgttacagcatctcgtattgtcacatcataatctgggcgaa
tgggggagtcctgttcagccacagacagctgaggcagtcgctctgcatcatatcgatgcg
atggatgcgaagctgcaaatggtggaggatgctttggataccacaccggagaccgaggaa
tggacaccgttcatcagaggtctagagaataaggctgtgtatcgtttgaagatttaa

DBGET integrated database retrieval system