KEGG   Paenibacillus odorifer: PODO_12390
Entry
PODO_12390        CDS       T03326                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pod  Paenibacillus odorifer
Brite
KEGG Orthology (KO) [BR:pod00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pod01001]
    PODO_12390
Enzymes [BR:pod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PODO_12390
Protein kinases [BR:pod01001]
 Serine/threonine kinases: Other
  Bacterial family
   PODO_12390
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PASTA APH Kinase-like Kdo RIO1 FTA2 Trypan_PARP Pkinase_fungal
Other DBs
NCBI-ProteinID: AIQ73979
LinkDB
Position
2823724..2825970
AA seq 748 aa
MIGHELGGRYQVIERIGGGGMALVYRAHDILLNRNVAIKVLRNQFVHDEEFIRRFRREAQ
SAASLSHPNVVSIYDVGQEDEIHYIVMEYIEGQNLNEIIKERAPLQVDESVRIASQICDA
LDHAHQNQIIHRDIKPHNILIGRNGRVKVTDFGIARAVTSTTITQTGSVVGSVHYFSPEH
AKGVSTGEKSDLYSLGIVLYQMLTGSLPFLGESPISVALKHLQEEFEEPKLLNPLIPQSV
ENVILRSMRKNPEERYDSAKEMLQDLETCLLPERRSEAKILFNDEEDEDRTRVIPAIKPI
QRSNGNRNHREERMVRDEDDEPVPSSKGKKQWAKPTLWIGLTLLLLLAMASLVWYVKSQL
VVPEVSVPYVVGKQIEQAQTELEDLGLEVADPILYDYSPNFEENVVIKQSREKDAKVKKG
ASLILTVNTAKPLPKMPDVVNKSFDDAVKALMALGVAQDRIDNKPLYDENTDEGLIVKSD
PALNTEFDPETVQITLYVSKGEESVLLPDLIGKTESEAKALLEGAKLVLGEVKQESSFSI
EEGKVTKTWAFDKGTGTSVPPGTAITIYLSTGYPPEALNYTFNVPVAPAQDGKKSKIRIE
FVDARNNGEKQDWGTRTIGKSQVLSVNLVLAPNKDGSVIVTRDGVLLDTYVIPYIDAKNG
TVQEPEPPVIATPQPTPTPSAEPTPTIEPTIEPEILPGSGSENDGGNNGAVNQTGFVNNS
SINSESTNNGNNKHNNKGKDKSKDKNNN
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgatcggtcacgaattgggcggccgttaccaagtcatcgaacggatcggcggaggtgga
atggcgctcgtctatagagcacatgacattcttttaaaccgaaatgtcgccatcaaagta
ttgcgcaatcagtttgtgcatgacgaggaatttattcgccgttttaggcgtgaggcgcaa
tctgccgcatctttgtctcatccgaatgtcgtcagcatatacgatgtaggacaagaagac
gaaattcattacattgtcatggagtatattgagggtcagaatcttaatgaaattataaaa
gaacgagcgccattacaggttgatgaatccgtacggatcgcttcacaaatctgtgatgcc
ctagatcatgcgcatcagaatcaaattattcatcgtgatataaaaccacataatatcctg
atcggacgcaacggccgggtgaaagtaaccgactttgggattgcccgcgcagttacgtca
acaaccattacacagaccggttctgtggttggttcagtacattatttctcgccagagcat
gccaaaggtgtctctacaggagaaaagtctgacttgtattcattaggtattgtactttat
caaatgcttaccggaagcctgcccttcttgggagagagtccgattagtgtagctttaaaa
catctgcaagaagagtttgaagaaccaaaacttctgaatccactcattccgcaaagcgtt
gagaatgtaattctgagatcaatgcgtaaaaatccggaagagcggtacgactctgccaaa
gaaatgttgcaggatttggaaacatgcttattgccggagcgccgcagtgaggcgaagatt
ctgttcaacgatgaagaagatgaggatcgtacgcgggttatcccggcgataaaaccgatt
caaagaagcaatggtaatcgtaatcatcgtgaggaacggatggttcgtgatgaagatgat
gaaccggtgccttcaagcaaaggtaaaaaacaatgggcaaaacccacattatggattggg
cttaccttgctgttgctgttggctatggccagtctcgtatggtacgttaaatcacagcta
gttgttcctgaggtttccgttccttatgtagtaggtaaacagatagaacaagcacaaact
gagcttgaggatttggggcttgaggttgctgatcctattctgtatgactacagtccgaat
tttgaagagaatgtggtcattaagcaaagtagggaaaaggatgccaaagtgaaaaaagga
gcgtccctaatactcactgtgaatacggctaagccactacctaagatgccagatgtagtt
aacaagagctttgatgatgcggttaaagcattgatggcgctgggtgtagcccaggaccgg
attgataataaacctctctatgacgaaaatacagatgaaggtctcattgtaaaatctgac
cctgcattaaatacagaattcgatcctgagacggttcaaatcaccctttacgttagtaaa
ggagaagaaagtgtactgttgccagatctcatcggtaagacggagagtgaggcaaaggcg
ctgctggaaggtgccaagcttgttcttggagaagttaaacaagaatccagcttcagcatt
gaagaaggtaaagtaacaaagacttgggcatttgataaggggacaggtacttctgttcca
cctggaacagcgattacgatttacttaagtacaggttatccacctgaagccctgaattat
acctttaatgtgccagtcgctcctgctcaggatgggaaaaagagcaagattcgtatcgaa
ttcgtggatgcgcgcaataatggagagaagcaggattggggaacacgtaccattggaaag
agccaagtgttatctgtgaatctagtattggctcctaataaagatggttcagttattgtt
acccgtgacggtgtacttttggatacttatgtaattccttatatcgatgctaagaacgga
accgttcaggagcctgaaccaccagttatagcaacaccacagccaactccaacaccttct
gctgaacctacgcctacaattgaacctacgattgaaccggagatcttgccaggttcaggt
tcagagaatgacggagggaataacggggcggtgaatcagacagggttcgtaaacaatagt
tctataaatagtgaatcgactaataatggcaataataagcacaacaataaaggcaaggat
aaatctaaagataaaaacaacaactaa

DBGET integrated database retrieval system