KEGG   Paenibacillus odorifer: PODO_14410
Entry
PODO_14410        CDS       T03326                                 

Definition
(GenBank) oxidoreductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
pod  Paenibacillus odorifer
Pathway
pod00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PODO_14410
Enzymes [BR:pod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     PODO_14410
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     PODO_14410
    1.1.1.-  
     PODO_14410
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Ldh_1_N Epimerase DUF1776 Sacchrp_dh_NADP TrkA_N NAD_binding_10 GDP_Man_Dehyd 3HCDH_N
Other DBs
NCBI-ProteinID: AIQ74349
UniProt: A0A1R0WUD7
LinkDB
Position
3224977..3225744
AA seq 255 aa
MSESYVKTAVITGAAGGIGKELARRLSDRKLNLVLVDLNEEAIKNVIQDLGLNESNSLAV
AADVSNEEDVQNYVNKAVEKFGAIDYFANNAGIEGPAGQIEELNVKALDLVYNVNVRGVF
LGLHYVIPVMKKQNSGAILNTSSLAGLMGAPGMAPYIMSKHAVIGLTRVAANELAPLGIR
VNAVLPGTINTQMMRKIENNFGSAEEYKAANEAATPMGRYGEPQEVAAVMNFLLSDEASF
VTGSLYTVDGGMIGQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagtgaatcatatgtaaaaactgctgtaattactggagctgcaggaggaatcggtaag
gagcttgcccgtcgattgtctgatcgtaaactgaatcttgtacttgtcgatctgaatgaa
gaagcgataaaaaatgttatccaagatttaggcttaaatgaatctaactctttagctgta
gctgcggatgtctctaatgaagaagacgttcagaattatgttaataaagcggtagaaaaa
tttggtgccattgattattttgcaaacaatgccggaattgaaggtccagcaggtcaaatc
gaagagcttaacgtcaaagcacttgatcttgtatacaacgtcaatgtacgtggtgtattt
cttggactacactatgtaattcctgtgatgaaaaaacaaaactcaggtgctattctgaac
acttcttctctggcaggactcatgggcgcaccaggcatggccccttacattatgtctaag
catgctgtaattggtctgactcgcgtagctgcaaatgagcttgcaccacttggcattcgt
gttaatgcggtactgccaggaacgatcaatacacaaatgatgcgtaaaattgagaataat
ttcggaagtgcagaagaatacaaggcagctaacgaagctgcaacaccaatgggtcgctac
ggtgaaccgcaagaagttgccgctgtgatgaacttccttctgtcggatgaggcttcattc
gtaacgggttctctatatacagtcgacggtggtatgataggtcaataa

DBGET integrated database retrieval system