KEGG   Paenibacillus odorifer: PODO_16830Help
Entry
PODO_16830        CDS       T03326                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pod  Paenibacillus odorifer
Pathway
pod00010  Glycolysis / Gluconeogenesis
pod00020  Citrate cycle (TCA cycle)
pod00620  Pyruvate metabolism
pod01100  Metabolic pathways
pod01110  Biosynthesis of secondary metabolites
pod01120  Microbial metabolism in diverse environments
pod01130  Biosynthesis of antibiotics
pod01200  Carbon metabolism
Module
pod_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODO_16830
   00020 Citrate cycle (TCA cycle)
    PODO_16830
   00620 Pyruvate metabolism
    PODO_16830
Enzymes [BR:pod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PODO_16830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 NQRA RnfC_N ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AIQ74785
LinkDB All DBs
Position
complement(3777736..3779382)
Genome map
AA seq 548 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKAGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
LTKDGQVCRVGEVVAIIEAEGDVPDQEGAATEAPAAQAPAAPAAPASNKASNFEYRFPEL
GEGLHEGEIIKMHIKAGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVLEVLTKDGQVCRVG
EVVAIIAAEGDVPEQEGHASAEADAAKGSANTTSSPAATSPADAKEGGSAGVTPAPDRDV
LATPSVRKFAREQKVDISKVNGTGKGGKITREDVEAFLKGGSTPAAPAAAAASEAPKAAK
TEAKAAPAAASGNVSLEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTELVAFRT
RMKPIAEKKGVKVTYLPFIVKALVAASRQFPALNAMIDEEAGEIVYKKYYNIGIATDTPN
GLIVPVIKDADRKSIWMIASSITDLAVRGRDGKLSANEMKGSTISISNIGSAGGMFFTPI
INFPEVAILGTGRISEKAVVKNGEIVVAPVMALSLSFDHRIIDGATAQNFMNYIKSLLNN
PELLVMEV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaagtttgaataccgatttcctgaactaggtgaaggtctgcatgaaggtgaaatc
atcaaaatgcatatcaaagccggtgacaaggtaacggatgatgatatcgtaatggaagtt
caaaatgacaaggcggtagttgaggtgccttgcccagtaaacggtactgtattggaagtt
ctgactaaagacggtcaagtatgccgtgtcggtgaagtggtggctattatcgaagcagaa
ggtgacgtgcctgatcaagagggtgctgctactgaagctcctgctgctcaagcgccagct
gcaccagctgctccagcatctaacaaagcatcgaattttgaatatcgcttccctgagctg
ggtgaaggtctgcatgaaggtgaaatcatcaaaatgcatatcaaagccggtgacaaggta
actgatgatgacatcatcatggaagttcaaaatgacaaggcggtagttgaggttccatgt
ccagtgaatggtactgtattggaagttctgactaaagatggccaagtttgccgcgtaggc
gaagttgttgctattatcgctgctgaaggcgacgttcctgaacaagaaggtcatgcatct
gctgaagctgatgcagcaaaaggaagtgcaaacactacttcttcccctgcagcaacaagc
cctgctgatgctaaagaaggcggatctgcaggtgtaacaccagctcctgaccgcgatgta
ttggctacaccaagcgttcgcaaatttgctcgtgagcaaaaagtggatatttccaaagtg
aacggaactggaaaaggtggcaaaatcactcgtgaagacgtagaagccttcttgaaaggt
ggttctacacctgcggctcctgcagcagcagcggcgtctgaagctcctaaggctgctaag
accgaagctaaagcagcacctgcagcagctagcggtaacgttagtcttgaagaagaacgt
gtaccattcaagggtattcgtaaggcgatctccaacgcaatggttaaatcggcttacact
gctccgcacgtaaccatcatggatgaagtagatgttactgaactggtagcattccgtacg
cgtatgaaacctattgctgagaaaaaaggcgttaaggttacttaccttccattcatcgtt
aaggctcttgttgcagcttcccgtcaattcccagcacttaatgctatgattgatgaagaa
gcaggcgaaattgtctacaagaaatactacaatatcggtatcgctactgatacaccaaac
ggtttgatcgttccagttatcaaagacgctgaccgtaagagcatttggatgatcgctagc
agcatcactgacttggctgttcgtggccgtgacggtaaattgtctgctaacgaaatgaag
ggcagcacgatctccatcagtaacatcggttctgctggcggtatgttctttactccaatc
atcaacttccctgaagtggctatcctcggaactggccgtatcagtgaaaaagcagttgtg
aaaaatggtgaaatcgtagttgctccagtaatggcgttgtcactcagctttgaccaccgt
attatcgatggtgcgactgctcaaaactttatgaactacattaaatcgctgctcaataat
cctgagctgctggttatggaggtataa

DBGET integrated database retrieval system