KEGG   Paenibacillus odorifer: PODO_20385
Entry
PODO_20385        CDS       T03326                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
pod  Paenibacillus odorifer
Pathway
pod00360  Phenylalanine metabolism
pod00362  Benzoate degradation
pod00650  Butanoate metabolism
pod01100  Metabolic pathways
pod01120  Microbial metabolism in diverse environments
pod01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PODO_20385
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PODO_20385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PODO_20385
Enzymes [BR:pod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     PODO_20385
SSDB
Motif
Pfam: 3HCDH_N 3HCDH F420_oxidored NAD_binding_2 Pyr_redox TrkA_N 2-Hacid_dh_C Shikimate_DH DAO Sacchrp_dh_NADP ApbA NAD_binding_7 UDPG_MGDP_dh_N DUF3479 Pyr_redox_2 NAD_Gly3P_dh_N FAD_binding_3 DFP NAD_binding_8 adh_short AlaDh_PNT_C Lycopene_cycl
Other DBs
NCBI-ProteinID: AIQ75431
UniProt: A0A1R0XKZ3
LinkDB
Position
complement(4559233..4560105)
AA seq 290 aa
MNFKKIGVIGGGTMGQGIAEMLAAKGLDVLLVEKTPEKLDYSYEMIETSLDKQLEKWAIT
QAEKKLILSRIQKVTHFAELSSCDMVIETIVEDLEEKKKILNQLDQVCPNHIILASNTST
LSLTELASSTMYPERVIGMHFIYPVAKVDLVEIVRGLKTSDATFEDTKSFVDEIVEKKGV
MIYESPGFVTSRLICLFINEAMHVLQEGVASAQDIDDAMRIGYQFQYGPLEMADRFGLDS
VLAALENMFREYGELKYRPSTILKKMVRAGQLGMKSGEGFFQYDKDGDRI
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaatttcaagaaaattggtgtcatcggcggtggcacaatgggacaagggattgccgaa
atgctggcagccaagggcctggatgtattgctggtggagaaaacccctgagaaactggac
tactcctacgaaatgatcgagacaagtctagataagcaactggagaaatgggcgatcact
caagctgagaagaagctgattcttagccgcattcaaaaagtgacacatttcgcagagctg
agctcttgtgacatggttatcgaaacaatcgttgaggatttagaagaaaagaaaaaaata
ttaaatcaactggatcaagtatgtccaaaccacattattcttgccagcaatacgtcaaca
cttagcttgactgaacttgcaagttctacaatgtatccggaacgcgtgatcggaatgcat
ttcatataccctgtagctaaagtggatcttgttgaaattgtacgcggtctgaaaacttca
gatgctacttttgaagatacaaaatcctttgttgatgaaattgttgagaaaaaaggtgta
atgatttatgaatccccaggatttgtaacatcacgcctcatttgcttgtttatcaatgaa
gctatgcacgtgctgcaagaaggcgttgcctccgcacaggatattgacgatgctatgcgt
attggttatcaattccaatatggaccgcttgaaatggctgacagattcggtctggattcg
gttcttgctgcacttgaaaatatgttccgtgaatatggtgagctgaaatatcgtccttcc
acgatccttaagaagatggtgcgtgcaggacaattgggtatgaaatcaggcgaaggcttc
ttccagtacgacaaggatggtgaccgtatatga

DBGET integrated database retrieval system