KEGG   Paenibacillus odorifer: PODO_21790
Entry
PODO_21790        CDS       T03326                                 

Definition
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
pod  Paenibacillus odorifer
Pathway
pod00620  Pyruvate metabolism
pod00640  Propanoate metabolism
pod00650  Butanoate metabolism
pod01100  Metabolic pathways
pod01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PODO_21790
   00640 Propanoate metabolism
    PODO_21790
   00650 Butanoate metabolism
    PODO_21790
Enzymes [BR:pod01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     PODO_21790
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: AIQ75686
UniProt: A0A1R0YYV8
LinkDB
Position
complement(4841477..4843738)
AA seq 753 aa
MSVIEKDVQEVKSGWRSFTKGKWSRKVDVNNFIASNIKPYEGNEEFLVGPTSNTTELWKI
ISQLSKEERERGGVWDVSLDTVSTITSHAPGYIDKDKEQIVGVQTDAPFKRSIQPFGGIK
MMVDATKAYGFELPQNIVDMFTNIRKTHNQGVFDAYTPDMRAVRKSGVITGLPDAYGRGR
IIGDYRRIALYGIDFLIKDKKQQQTELEVDSMTEDIIRLREELSEQIRALGELKEMAAAH
GMDISRPATNFKEATQWVYFGYLAAVKEQNGAAMSLGRVSSFLDIYAERDIAEGTLTEEQ
VQEIVDHFVMKLRIVKFLRTPDYNDLFSGDPTWVTESIGGMAEDGTTRVTKNSFRFLNTL
YNLGPAPEPNLTVLWSEKLPEAFKKYCAKVSIETSAIQYENDDVMRPYWGEDYAIACCVS
PMRIGKQMQFFGARANLAKALLYAINGGIDEKSGAQVGPEFPAITSEYLDYDEVMKRFKP
MMEWLAKTYVNTLNIIHYMHDKYSYERIEMALHDRDILRTMACGIAGLSVAADSLSAIKY
AKVKPIRNEQGIAIDFETEGEFPCYGNNDDAVDSIAVELVETFMTMIRKNKTYRDSVPTQ
SVLTITSNVVYGKKTGTTPDGRKKGEPFAPGANPMHGRDKKGALASLNSVAKLPYSDAQD
GISNTFSIVPKALGKDEDSRKSNLVHMMDGYFHNNAQHLNVNVFNREQLMDAMEHPENYP
QLTIRVSGYAVNFIKLTREQQMDVINRTFHGSM
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgtcggtgattgaaaaagatgtacaagaagtgaaatccggttggagaagttttacaaaa
ggtaaatggtccagaaaagttgacgttaacaactttatcgcaagtaacattaagccttat
gaaggaaacgaagaattcctcgtaggacctactagtaacacaactgaactatggaagatt
atttcccaattgagtaaggaagaaagagaaagaggcggcgtatgggatgtttccctagat
actgtctccacaatcacttcacatgctccaggctacattgacaaagacaaggaacaaatt
gtaggcgtacagactgacgctcctttcaaacgttccatccagccatttggcgggatcaag
atgatggttgatgctacgaaggcttacggcttcgagcttccacaaaacatcgttgacatg
tttacgaacattcgcaaaacgcataaccaaggcgtatttgatgcatatacaccagacatg
agagctgtgcgtaaatccggcgtaattacaggtcttcctgatgcttacggccgcggacgc
atcatcggcgactaccgccgcattgctctgtacggtattgatttcctcattaaagacaaa
aaacaacaacaaactgagcttgaagttgattccatgactgaagatattattcgtttgcgt
gaagagctgtccgagcaaattcgtgcacttggcgaattgaaagaaatggcagccgctcat
ggtatggatatttccagaccagcgaccaacttcaaagaagctactcaatgggtatacttc
gggtatcttgcagcagttaaagagcaaaatggtgcagcgatgtccctaggccgtgtgtcc
tctttcttggacatctatgcagaacgcgatattgctgaaggtactttgactgaagaacaa
gtacaagaaatcgtcgatcatttcgtaatgaaactgcgtatcgtgaaattcttgcgtaca
cctgactataatgatctgttctccggtgacccaacatgggtaactgaatccatcggtggt
atggctgaagacggaacaactcgtgttaccaagaacagcttccgtttcttgaacaccctg
tacaacttgggtccagctccggaaccaaacttaactgtactgtggtccgaaaaattgcct
gaagccttcaaaaaatattgtgctaaggtttccattgaaactagtgcaattcagtatgaa
aatgacgatgtaatgcgtccatactggggtgaagattatgcgattgcttgctgcgtatct
ccaatgcgtatcggtaaacaaatgcagttcttcggcgctcgtgccaacctggcaaaagca
ttgctgtatgctatcaatggtggtatagacgaaaaatccggagcacaagttggaccggaa
ttcccagcgatcacttctgaatatctggattatgacgaagtaatgaaacgtttcaaaccg
atgatggagtggttggctaaaacttatgttaacactttgaacatcattcactatatgcat
gacaaatattcttacgaacgtatcgaaatggcgctgcatgaccgtgacattctgcgtacg
atggcttgtggtattgctgggctgtccgttgcagctgactcactaagcgcaattaaatac
gccaaagtaaaacctattcgtaacgaacaaggtattgcgatcgacttcgaaaccgaaggc
gaattcccttgctacggtaacaatgacgatgctgtagacagcatcgcagtagaattggtt
gaaaccttcatgactatgatccgtaaaaacaaaacatatcgtgattctgtgccaactcaa
tcggtactgaccattacttcgaatgtagtgtacggtaagaagacaggtactacacctgac
ggacgtaagaaaggtgaacctttcgcaccgggtgctaacccaatgcacggacgtgacaag
aaaggcgccttggcttccctgaactctgtagctaaactgccttactccgatgcacaagat
ggtatctctaacacgttctccatcgtacctaaggcacttggtaaagacgaggattcccgt
aagtctaacctggtacacatgatggatggatacttccataacaacgctcagcatttgaat
gttaacgtatttaaccgtgaacagctgatggacgctatggagcacccagagaactatcca
caattgactattcgtgtatccggctatgcagttaacttcatcaagctgactcgcgaacaa
caaatggatgtaatcaaccgtacattccacggttcgatgtaa

DBGET integrated database retrieval system