KEGG   Paenibacillus odorifer: PODO_21795
Entry
PODO_21795        CDS       T03326                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pod  Paenibacillus odorifer
Pathway
pod00010  Glycolysis / Gluconeogenesis
pod00071  Fatty acid degradation
pod00350  Tyrosine metabolism
pod00620  Pyruvate metabolism
pod00625  Chloroalkane and chloroalkene degradation
pod00626  Naphthalene degradation
pod00650  Butanoate metabolism
pod01100  Metabolic pathways
pod01110  Biosynthesis of secondary metabolites
pod01120  Microbial metabolism in diverse environments
pod01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pod00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODO_21795
   00620 Pyruvate metabolism
    PODO_21795
   00650 Butanoate metabolism
    PODO_21795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PODO_21795
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PODO_21795
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PODO_21795
   00626 Naphthalene degradation
    PODO_21795
Enzymes [BR:pod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PODO_21795
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PODO_21795
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: AIQ75687
UniProt: A0A1R0YZ06
LinkDB
Position
complement(4843991..4846612)
AA seq 873 aa
MAVKNEVAAQVKQTTAEEYIQTLVDKAKKAHEAFMALDQEQVDTIVHAMALAGLDKHMYL
AKLAVEETGRGVYEDKITKNIFSTEYIWHGIKYDKTVGVIEDNAYESFQKIAEPVGIVMG
ITPVTNPTSTTMFKALISIKTRNPIIFGFHPSAQECSAAAARILHDAAVKAGAPENCIQW
IEMPTMDKTNALMNNPDVALILATGGSAMVKAAYSCGKPALGVGPGNVPAFIEKSADIDQ
AVTDIILSKTFDNGMICASEQAVIIEEPIFDQVKKKMIANGCYFVNKEEAAKLTSGAMNV
DKCAVNPAIVGQSAVKIAEMCGIQVPAGTKILVAELEGVGTKYPLSAEKLSPVLACYKVK
NADQGIERAAQVVEFGGMGHSSAIHSNNEEVIMKFSNRLQTGRILVNSPSTHGAIGDIYN
TNIPSLTLGCGSYGRNSVSQNVTAINLINVKRVNRRTVNMQWFKVPDKIYFEKGATQYLT
KMPDITRVAIITDPMMVKLGYVERVEHYLRQRQTPVAIEVFSEVEPDPSTTTVEKGTAMM
NRFQPDCIIALGGGSPMDAAKGMWLFYEHPDADFNGLKQKFMDIRKRVYKFPKLGNKAKF
VAIPTTSGTGSEVTSFAVITDKTTEQHTKYPLADYELTPDVAIIDPEFVYSLPKTAVADT
GMDVLTHAIEAYVSVMASDYTDGLAIKAIQLVFQYLEKSALEGDRVAREKMHNASTLAGM
AFANAFLGINHSLAHKWGGQYHTAHGRTNAILMPHVIRYNAKKPTKFASFPKYSHFVADE
RYAEIARILGLPARTTEEGVTSLINAIRDMNKKLGIEESFQQLGFDPKDFESRVDYLADR
AFEDQCTTANPKLPLVSELADVYRNAFYGRFDN
NT seq 2622 nt   +upstreamnt  +downstreamnt
atggcagttaagaacgaagtcgccgcccaagttaaacaaactaccgctgaagagtatatt
cagactttagtggataaagcgaaaaaagcacatgaggcattcatggcgctggatcaagag
caagttgacacaatcgttcatgcaatggcgttggctggactcgacaaacatatgtacctc
gctaaattggctgtagaagaaactggccgcggggtttacgaagacaaaattactaaaaac
atcttctcgacagaatatatctggcacggaattaaatacgataaaacagtaggcgttatt
gaagacaatgcttatgaaagcttccaaaaaattgctgagcccgtcggaattgtaatgggt
atcacaccggtaaccaaccctacatccaccacgatgtttaaagcgttgatttcgattaag
acacggaaccctattatattcggtttccacccatctgcgcaagagtgtagtgcagctgct
gctagaattcttcatgatgcggctgtaaaagctggcgcacctgagaattgtatccaatgg
attgaaatgccaacaatggacaaaacaaacgctttgatgaacaaccctgacgttgcactt
attctcgcaacaggcggttcagcaatggtaaaagcagcttatagctgtggtaaaccagct
cttggcgtaggtcctggtaacgtacctgcattcatcgaaaagagcgcggatatcgatcaa
gccgtaacggacatcattctttccaaaacatttgataatggtatgatctgtgcttccgag
caagctgttattatcgaagaaccaatctttgatcaagtgaaaaagaaaatgatcgctaat
ggctgctactttgttaacaaagaagaagctgccaaacttactagcggcgctatgaacgtt
gataaatgtgcggttaacccagcaatcgttggacaatccgcagtgaaaattgctgaaatg
tgcggcattcaagttcctgccggcactaagattctggtagcagaacttgaaggtgtaggc
actaaatatccattgtccgctgaaaaattgagtcctgtgcttgcttgctacaaagttaaa
aacgcagatcaaggtatcgaacgcgcagcacaagttgttgaatttggtggtatgggccat
agttcggctatccactccaacaacgaagaagtaatcatgaagttctccaaccgtctgcaa
acaggacgtattctcgttaactcgccttccactcatggtgcgatcggcgatatctataac
actaacatcccttcgttgacgctgggctgcggatcttatggtcgtaactccgtgtcgcaa
aacgttacagcaattaatttgatcaacgtgaaaagggtgaatcgtcgtaccgtgaatatg
caatggtttaaagtacctgacaagatctatttcgaaaaaggcgctactcagtacctgacc
aaaatgcctgatatcacacgtgtcgcaattatcactgacccaatgatggttaagctcgga
tatgttgagagagttgaacattacctgcgtcaacgccaaactcctgtagcgatcgaagtg
ttctcggaagttgaaccagatccatcgacaactacagttgaaaaaggtacagcaatgatg
aacagattccaaccggactgcatcatcgcacttggtggtggttccccaatggatgctgca
aaaggaatgtggttattctatgaacatccagacgcagactttaacggtctgaaacaaaaa
ttcatggatatccgtaaacgggtttacaaattccctaaacttggaaacaaagctaagttt
gtagcgattccaactacttcgggtacgggttcggaagtaacatctttcgcagttattacc
gataaaacaactgaacaacacactaaatatcctttggctgactacgagctaactccagac
gtagctatcattgatccagagttcgtatatagcttgccaaaaactgctgtagctgataca
ggtatggacgtattgacacatgccatcgaagcttatgtatcagttatggcgagtgactac
actgatggtctggcaattaaagcaatccaattggtattccaataccttgaaaaatcggcg
cttgaaggcgacagagttgcccgtgagaaaatgcataacgcatcaacacttgctggtatg
gcctttgctaatgctttcctgggtattaaccacagtttagcgcataaatggggcggtcaa
tatcacactgctcacggtcgtactaatgcgatccttatgccacacgttattcgttacaat
gctaagaaacctacgaagttcgcttcgttccctaaatattcacacttcgtagctgacgag
cgttatgcagaaatcgcccgtattctgggattgccagctcgcacaactgaagaaggtgta
actagcctgatcaatgctattcgcgatatgaacaaaaaactgggtatcgaagaatccttc
caacaactgggctttgatcctaaggattttgaatcccgtgtagattacttggctgaccgt
gcatttgaagatcaatgtacaactgccaatcctaagctgccactggtatctgaacttgca
gatgtgtaccgtaatgctttctacggaagatttgataattaa

DBGET integrated database retrieval system