KEGG   Paenibacillus odorifer: PODO_25955Help
Entry
PODO_25955        CDS       T03326                                 

Definition
(GenBank) alpha amylase
Organism
pod  Paenibacillus odorifer
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_25 CBM53 fn3 RGI_lyase CBM_20 DUF1966 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AIQ76409
LinkDB All DBs
Position
complement(5777108..5780167)
Genome map
AA seq 1019 aa AA seqDB search
MKRKLWYVPVLITSILLSTVINLFILAPQQADAASIGTINENDTIYQIMVDRFNDGDSSN
NATGAAIRYGENSEEDFRYMKGGDWQGVIDKLSYIKNMGYTAIWISPVAEPQMTNRENNG
SGKNTAYHGYNVKDPNAANPYFGTKEKLKELVDSAHAVGIKVVIDVVPNHIGDYMLGTQA
YYDIPSLQPAAPFNNPAWYHHNGDINWSLADGRYDQWAQDYLENHDLGGLDDIDFDVPAA
KKAVFDSIKGWFDYTGADGARVDAAKLMKPTDIGELQNYLGVNTFGENFDGNAEFVSRWV
GNNKEWGMLDFPMFFSVLNSFAYGQSFDSNIKSTLAQDSYYNGNANHMVTFIDNHDRNRF
LTEAGGSVDKLQNALTFIFTVRGTPVVFQGTEQNKGNGNGQIMTGGIADTWNRWSMVKRD
ANGNVLENYFNENASTYKHVAKLNEIRKNNPALRTGTQREMWSAQNLYAFSRRIDTGTNL
GQEVISVFSNKSSGSQTVTIPLRAESSLAVGTVLYNQLNTSDTVTVQSGGATGKQITVTV
GANAAKIYAKQQLPTDTVAPTVPTNVTATVQNASSALVSWTASTDNVGVTGYEIYRNGVK
VGTSATTSYTDNGLSASTTYDYTVKAMDAAGNLSLLSAIASVTTPAGNSVTIYYKQGYTS
PYIHYRPVGGTWTTSPGVAIPVSDVAGYNKITINIGSASQLEACFNNGSGTWDSNGGSNY
LFSAGTWTYTPTGNIQSGGPVTPTPTVTPTPSPTVTPTPTVTPTPTPTVTPTPTPTPTVS
PTSTPTPTLTPTPTPTPTPTPTATPTPTVTPTPTPTATPVGSTATIYYKNAAYSSSYIHY
KLDGSTVWTTSPGEQLQASAFTGYKAVTIQLGTAAGLTAAFNNGSGTWDNNGGNNYHFAA
GTWSMVNGNITAGEPQADSVTFRVTVPASTPVSGPVYLSGSFNSWNVADPNYQLTKGSDG
IYSITLSLPAGTAIQYKVTRGAWTNVEVNSNGSDLSNRTLTPSGGAQTVNLTVQRWKDL
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtaagttatggtacgtgcccgttctgattacatctattcttctttctactgtg
attaatttattcatcttagcgccacaacaggcagatgcggccagcatcggtacgattaac
gagaatgataccatttatcagattatggttgaccggtttaatgacggggactcttccaac
aatgctacgggagcggcaattcgctatggcgagaactctgaagaagatttccgttatatg
aaaggcggagattggcaaggggtgatcgacaagctgtcttatattaaaaatatgggctac
accgcgatctggatttccccagtggcggagccgcaaatgacgaatcgggagaacaatggc
agcggtaaaaatacagcgtatcacgggtacaatgttaaggaccctaacgcagccaatccc
tactttggtacaaaggagaagcttaaggagttagtggattccgcacatgcggttggcatc
aaggtagtgatcgacgttgtgccgaaccatatcggggattatatgctgggtacccaagcc
tactatgatatccctagtctgcagccagcagctccttttaataacccggcttggtatcac
cataatggagatatcaactggtctttggcagacggaagatacgatcaatgggcacaggat
tacttagaaaatcatgatctaggcggactggatgacattgacttcgatgtccctgccgct
aaaaaagccgtatttgattcgattaaaggctggtttgactatacaggagcagatggtgca
cgtgtagacgcagccaagctgatgaagccgactgatattggtgaactgcaaaattatctg
ggggttaatacctttggcgagaattttgacggcaatgctgaatttgtctcacgctgggtc
ggcaacaacaaggagtggggcatgcttgatttcccaatgttcttctccgttctaaatagc
ttcgcatatgggcagtcttttgactccaatattaaaagcaccttggcacaggattcctac
tacaacggaaatgccaatcacatggttacctttatcgacaatcatgaccgcaatcgtttt
ctcacagaagctggaggaagcgtagataagctgcagaacgctttgacttttatttttaca
gtgcgtggaacacccgtagtcttccaaggtacggaacagaacaaaggcaatggtaatgga
cagattatgacgggaggcatcgccgatacctggaaccgctggtcaatggtgaaacgggat
gcaaacggcaatgtattagagaattattttaatgagaatgccagcacctacaagcacgta
gccaaacttaatgagattcggaaaaataatccggcactccgtacaggcactcaacgtgaa
atgtggtctgcacagaacttatatgctttttcacgtcgtatcgacactggaactaatctg
gggcaggaagttatctccgtatttagtaataaatccagcggctcgcagaccgttaccatt
ccactgcgtgcagagagcagcttggcagtcgggacggttctttataaccagttgaacact
tcggatacggtaactgtacaatcgggtggagcaactggcaagcagatcactgtaaccgtg
ggtgcaaatgcagccaaaatttatgcaaaacaacagcttcctacagatacagtggctcca
actgtaccaactaacgtgaccgcaactgttcaaaatgcatccagtgctttagtaagctgg
accgcttccaccgacaatgtaggtgtgaccggatatgaaatttatcgcaacggcgtcaaa
gtgggtacatccgcaactacttcatatacggataacggattatccgccagtactacgtat
gactatacggtaaaagcaatggatgcagcaggcaatctatccctccttagcgcgattgct
tcagtgacaacaccagcggggaacagtgtcactatttactataagcagggctatacctcg
ccttatattcattatcgccctgtaggaggaacttggacgacatcaccaggtgtggcgata
cctgtctctgatgtagcaggctacaacaaaataacgattaatatcggctcagccagccag
cttgaagcttgctttaacaatggcagcggtacttgggacagtaacgggggcagcaactat
ttatttagtgccggcacctggacttatacaccaactggcaatattcaatcgggtggacca
gtgacgccgacaccaacggtaacaccgacaccatcaccaaccgtaacgcctacaccgacg
gtaacgccgacaccgacgccaaccgtaacgccaacaccgacaccgacgccaacggtatcg
ccaacgtcaacaccgacaccaacgctaacgccgacaccaacgccaacgccaacgccaacg
ccaacggcaactccgacaccgaccgtaacgcctacaccaacgccaacggcaacacctgtc
ggcagcacggcaacgatctattataagaatgcggcttatagcagctcttatatccattat
aagctcgatggttcaacggtctggacgacgtctccaggcgagcagctccaagcttctgct
tttacaggatataaggcggttacgattcagctgggcacggcagctgggctgaccgcagcc
tttaataatggcagtggcacatgggataacaatggcggcaataactatcattttgctgcg
ggcacctggagtatggtgaatggcaacatcaccgcaggagaaccacaagcggatagtgtt
acattccgagtaactgttcctgcgtctactcctgtgagtggtcccgtttatctctccggc
tctttcaatagctggaatgtggcagatccgaactaccaactgacgaagggcagtgatggt
atttactccatcacactaagtctaccggcgggaacagcaattcaatacaaagttacacga
ggcgcttggactaatgtggaggtgaattcgaatggatcggatctttccaatcgaaccctt
acgccatcaggcggtgcacaaaccgtaaatctgacggttcagcgctggaaggatctataa

DBGET integrated database retrieval system