KEGG   Paenibacillus odorifer: PODO_26265Help
Entry
PODO_26265        CDS       T03326                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pod  Paenibacillus odorifer
Pathway
pod00010  Glycolysis / Gluconeogenesis
pod00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pod00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODO_26265
   00500 Starch and sucrose metabolism
    PODO_26265
Enzymes [BR:pod01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PODO_26265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: AIQ76460
LinkDB All DBs
Position
complement(5874749..5876161)
Genome map
AA seq 470 aa AA seqDB search
MNLQFPEGFLWGGAVAANQLEGAYQDDGKGWSTQDVMPHGIKSAPTEVPTDDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRTSIAWSRIFPKGDEPEPNEQGLQFYDDLFDECHKYGIEP
LVTISHYETPLHLAREYDGWVNRKMVDFYERYVRTIFNRYKNKVKYWLTFNEINSILEFP
FMSGGINTPLEKLSKQDLYQAIHHEFIASALAVKIGHEINPDFKIGCMVLSMPIYPLTPH
PDDLIKAMQSDHKNMFFADVHSRGYYPGYMKRFFKENGIHIHFEPGDEEILKHTVDFISF
SYYMSTCETADPEKQIRGEGNLLGGVANPYLEASEWGWQIDPQGLRYVMNMFYDRYQKPL
FIVENGLGAVDQLVVDGNGEKIVNDDYRINYLRDHLVQVAEAIADGVEVMGYTSWGCIDL
VSATSAELKKRYGFIYVDRHDDGSGTLERYRKKSFHWYKEVIESNGQSLF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacaatttccagaaggattcctatggggtggggctgtagccgctaaccagctt
gaaggggcatatcaggatgatggcaaaggctggtctacccaagatgtcatgccacatggc
attaagtctgcgcctacagaagttcctaccgacgataacatgaagttgattggcatcgac
ttctatcaccgatataaagaagatattaagctgtttgcggaaatgggctttaaagtattc
cggacgtctattgcctggtcacggatttttccgaaaggggacgagccggagccgaatgaa
caaggcttgcagttctacgatgatctatttgatgagtgtcataaatacggcattgagccg
ctagttactatctcccattatgagaccccgctgcatttggcacgagagtatgatggatgg
gttaaccgtaagatggtggatttttacgagcgatatgtgagaacgatctttaatcgttac
aagaataaggttaaatactggctgaccttcaacgagatcaattctatcctagagttccca
tttatgagtggcggaatcaatactccattggagaaattgagtaagcaggatctgtatcag
gccattcaccatgagttcattgcaagtgctttggcggtgaagatcggtcatgagatcaat
cctgatttcaaaataggctgtatggtgctgagcatgccaatttatccgctcactccgcat
ccggacgatttgatcaaggcgatgcaaagcgatcacaaaaatatgtttttcgcggatgtt
catagcagaggttactatccaggatatatgaaacggttctttaaggaaaatggaatccac
attcattttgagccaggggacgaagaaattctgaagcataccgtggatttcatatctttc
agttactatatgagcacatgtgaaacggccgatccggagaaacagatcagaggagaagga
aatctgctgggcggggtagcgaatccatatctggaagcgagcgaatggggttggcagatc
gatccgcagggcttgcgttatgtgatgaatatgttctatgaccgataccaaaaaccgcta
tttatcgtggaaaatggccttggcgccgtcgatcagctggttgtagacgggaacggtgag
aagatagtaaacgacgattaccggatcaattatttgcgagatcatttggttcaagtagca
gaagctattgccgatggcgtggaagttatggggtatacgagctggggctgcatcgacttg
gttagcgcaacaagcgccgagctgaagaaacgttatggcttcatttatgtagatcgtcat
gatgatggttcaggtacactggagagataccgtaagaagtccttccactggtacaaagaa
gtaatcgaatcgaatggacaaagcctgttctaa

DBGET integrated database retrieval system