KEGG   Pontibacillus sp. HMF3514: GS400_19700Help
Entry
GS400_19700       CDS       T06374                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pof  Pontibacillus sp. HMF3514
Brite
KEGG Orthology (KO) [BR:pof00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GS400_19700 (ahpF)
Enzymes [BR:pof01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GS400_19700 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Thi4 FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 K_oxygenase CryBP1 BAR_2 FANCI_S3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QHE54108
LinkDB All DBs
Position
3915628..3917151
Genome map
AA seq 507 aa AA seqDB search
MLEADIKSQLEQYLQLMENDILLKVSAGSDDVSKEMLALVEELASMSSKINYEEAELSRT
PSFSVNRIGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKIDQDKIDQIKNISGEYNFE
SYVSLSCHNCPDVVQALNMMSILNPGITHTMIDGATFKDEAESKNVMAVPSVHLNGEFFS
GGRMTLEEILDKLVEGPSAEELSSKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAERF
GGQVLDTMSIENFISVSHTEGPKLVSSLEEHVKDYDIDVMNLQRASGLQKNDMFELELDN
GAVLKSKSVIVSTGARWRQLGVPGEKEFQNKGVAYCPHCDGPLFEGKDVAVIGGGNSGVE
AAIDLAGIVKHVTVLEFGAEMKADEVLQNRLHSLPNVTVKTNAQTTEITGTDNVDGLTYI
DRETEEEHRIDLEGVFVQIGLIPNTEWLEGVDTNRIGEIVVDKTNATNIPGLYAAGDVTD
NPNNQIIIAMGDGANASLGAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagcagatattaagtcacaattagaacaatatctccaattaatggagaatgat
atactgcttaaagttagtgcaggttcagatgatgtatctaaggagatgctagctcttgtc
gaagagctagcatctatgtcttctaagattaattatgaggaagcagaactatctagaacc
cctagctttagtgtaaatcgtattggagaagacactggagttacgtttgctggtattcct
ttaggacatgagtttacttctctagtgttagctcttctacaagtgagcggtagagctcct
aagattgatcaagacaaaattgatcaaattaaaaatatcagcggagagtacaactttgaa
tcatacgtaagcttaagctgtcataattgtcctgatgttgtacaagccctaaacatgatg
agtattttaaacccaggaattactcataccatgattgatggtgcaacgttcaaggatgaa
gcagagagcaaaaatgttatggcagtaccatctgttcacttaaatggtgaattctttagt
ggcggtcgtatgacacttgaagaaatccttgataagttagttgagggcccaagtgctgaa
gagctttcaagtaaagatccttacgatgtccttgttgtcggcggaggtcctgctggcgca
agtgccgcaatctatgctgcacgtaaaggcatccgcacaggcatcgttgcagagcgcttt
ggtggacaagttcttgacacaatgagcattgaaaactttatcagcgtatcccatacagaa
ggccctaaacttgtctcaagcctagaggaacacgtcaaagattatgatattgatgtcatg
aatcttcagcgtgcaagcggcttacaaaagaatgatatgttcgaacttgagctcgataat
ggtgcagttctgaaaagtaaaagtgtcattgtatcaacaggcgctcgctggcgtcagctc
ggagttcctggtgaaaaggaattccaaaacaaaggcgtagcgtattgccctcactgtgat
ggaccattgtttgaaggaaaagacgtagctgttatcggtgggggtaactctggagttgaa
gcagcgattgaccttgcaggtatcgttaaacatgtaacggtccttgagtttggtgcagaa
atgaaagcagatgaagttctacagaatcgcctgcacagccttccaaacgttacagtcaaa
accaatgcccaaacaaccgaaatcacaggtacagacaacgtcgacggcctaacctatatc
gatcgcgaaaccgaagaagaacaccgcattgatttagaaggagtcttcgtccaaatcgga
cttattccaaacactgaatggcttgaaggcgttgacacgaaccgcattggtgaaatcgta
gtcgataagacaaacgctacaaacatccctggcctatacgcagcaggagatgtcacagac
aatcctaacaatcagatcatcattgccatgggcgatggtgcaaatgcttcattaggggct
tttgattatctgattcggaactaa

DBGET integrated database retrieval system