KEGG   Pyrobaculum oguniense: Pogu_2413Help
Entry
Pogu_2413         CDS       T01735                                 

Definition
(GenBank) DNA ligase I, ATP-dependent (dnl1)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pog  Pyrobaculum oguniense
Pathway
pog03030  DNA replication
pog03410  Base excision repair
pog03420  Nucleotide excision repair
pog03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pog00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pogu_2413
   03410 Base excision repair
    Pogu_2413
   03420 Nucleotide excision repair
    Pogu_2413
   03430 Mismatch repair
    Pogu_2413
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pog03032]
    Pogu_2413
   03400 DNA repair and recombination proteins [BR:pog03400]
    Pogu_2413
Enzymes [BR:pog01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Pogu_2413
    6.5.1.6  DNA ligase (ATP or NAD+)
     Pogu_2413
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Pogu_2413
DNA replication proteins [BR:pog03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Pogu_2413
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Pogu_2413
DNA repair and recombination proteins [BR:pog03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Pogu_2413
   NER (nucleotide excision repair)
    Other NER factors
     Pogu_2413
   MMR (mismatch exicision repair)
    Other MMR factors
     Pogu_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 PocR
Motif
Other DBs
NCBI-ProteinID: AFA40440
UniProt: H6QD97
LinkDB All DBs
Position
complement(2091918..2093672)
Genome map
AA seq 584 aa AA seqDB search
MQFGELVKALAAVESTTQRSVMVKLLASLFKKALPEEIDKVIYLILGDLRPPWEGLELGV
GEKLCLRALAKATGTSQAELESLYKKTGDIGEAARRSLASSKRPGLLTFGSQKPLEVSEV
YDTLLKVARASGEGAQDMKIALLSSLFARSSPEEGKYIARFVVGKLRLGVADMTIIEALA
DAYGVRKEDLERAYHVYPDLGHLAKLVASGKPLDEVKVTPGVPVLPMLAQRLSSSSEILA
KLGGTAICEYKYDGERAQIHISQSGVRIFSRRLEDITHAYPDVVKAVKEAVMAREAILEG
EIVAVDPDTGEMLPFQELMHRKRKHEVVAAMEMYPTVLYLFDVIFVDGEDLTNEPLIYRR
VKLSEIVQESDKVQIAKWLMLDDPDSVDVFFHEAVSVGTEGLICKSPTSEYEMGARGWNW
IKYKRDYKSEMIDTVDLVVVGAFYGRGKRAGLYGAFLLAAYDPSSDMFYTVCKVGSGFTD
ADLKKMYEILQPLKIPHRHPRVSSKMEADVWFVPQVVIEVIGAEITLSPLHTCCLGAVRP
GVGLAVRFPRFTGRYRTDKGPEQATTVAEMLELYKRQKKVAQPE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtttggtgagttggtaaaggcgctcgccgctgttgagtccacgacgcagaggagc
gtaatggttaagcttttggcttcgctcttcaagaaggcgttgcctgaggagatagacaaa
gttatctacctaattttgggggatttgagacctccttgggagggccttgagttgggggtg
ggggagaagctgtgtctcagagctttggcaaaggccactgggacatcccaggcggagctg
gagtccctatacaagaagactggtgacataggtgaggcggcgcggcgatctcttgcatcg
tctaagcgaccggggctactgaccttcggctcgcagaagccgctggaggtgtccgaggtt
tacgacaccctactcaaagtggcgagggcaagcggcgagggggcgcaagacatgaaaatc
gcccttctctcctcgctgtttgccaggtcctcgcctgaagaggggaagtacatcgcccgt
tttgttgttgggaagcttaggctcggcgttgccgacatgacgataatcgaggcgctggcg
gatgcctacggtgtgagaaaggaggatttagagagggcctaccacgtctaccccgacctc
ggccacctcgccaagctcgtcgcctccgggaagcccctggacgaggtgaaggtgacgcct
ggcgtccccgttcttcccatgttggcgcagaggctgtcctcatcgtctgagatcttggct
aagctgggcggcacagcgatatgtgagtataaatacgacggggagagggcgcagatacat
atatcgcagagcggggtgaggattttcagtcggaggcttgaggacattactcacgcctat
ccagacgtggttaaggccgtgaaggaggctgtaatggcgagagaggccattctagagggg
gagatcgtggcggtggatccagacaccggcgaaatgttgccgtttcaagagcttatgcac
aggaagaggaagcacgaggtggttgcggcgatggagatgtatcccacggtcctatacctc
ttcgatgttatattcgtcgacggggaggatttgaccaacgagcctttgatataccgccgc
gtgaagctctctgaaattgtccaagaaagcgacaaggtgcagatagcgaaatggctgatg
ctcgacgatccagattcagttgacgtgtttttccacgaggccgtctcagtgggcacagag
ggtctcatctgcaagtcgccgacatcggagtacgaaatgggggcgagggggtggaactgg
attaagtacaagcgtgattacaagagcgagatgatagacacggtagatctagtggtggtg
ggggccttctacggccgtggaaaaagagccggcctctacggcgcctttctcttagccgcc
tacgacccctccagtgatatgttctacaccgtgtgcaaagtgggtagcggctttacagac
gcagatttgaagaaaatgtatgagatcctccagcctctaaaaatacctcacagacacccc
cgggtatcatcaaagatggaggccgacgtgtggtttgtgccgcaggtggtaatagaggta
atcggcgcagagataactctctctccgctacacacttgttgtctcggcgccgttaggcct
ggggttgggctagcggtgaggttcccccgcttcaccggccgctataggacagacaagggg
ccggagcaagccaccacggtcgccgagatgctagagctctacaaaaggcagaaaaaggtg
gctcagcctgagtag

DBGET integrated database retrieval system