KEGG   Polynucleobacter paneuropaeus: DPM16_00810Help
Entry
DPM16_00810       CDS       T05507                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
poh  Polynucleobacter paneuropaeus
Pathway
poh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
poh01100  Metabolic pathways
poh01110  Biosynthesis of secondary metabolites
poh01130  Biosynthesis of antibiotics
poh01230  Biosynthesis of amino acids
poh02024  Quorum sensing
Module
poh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:poh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DPM16_00810
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    DPM16_00810
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DPM16_00810
Enzymes [BR:poh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     DPM16_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AWW43893
LinkDB All DBs
Position
complement(137270..138775)
Genome map
AA seq 501 aa AA seqDB search
MQLDEFNALAKQGFNRIPLVKEVLADLETPLSLYVKLTQAFGKKNTYLLESVVGGERFGR
FSFIGLPAKTLLRTAGTPTAPLTEILTDGKVVESNRDNPLDFIDAYFKRFKVPLQTGLPR
FCGGLAGYFGYDTVRYIEAKLASHNLPDELGVPDIQLMLTEELAVIDNVTGKIYFIVYAD
PAEPNGFEKAQVRLKELLACLSKPFSMPVSRPSNKTDLVRNFKAADFEKAVLKTKEYILA
GDCMQVVIGQRISKPFTDSPLALYRALRSLNPSPYMYYYDFGDLQVVGSSPEILVRQELR
GGEKMVTIRPLAGTRPRGSTPQEDERLAKELLADPKEIAEHVMLIDLARNDVGRIAKTGS
VQVTDSMSIEKYSHVQHIVSSVEGQLLDNMSNMDVLRATFPAGTLSGAPKIRAMEIIDEM
EVVKRGVYGGAVGYLSFSGDMDVAIAIRTGVIRNGVLHSQAGAGVVADSDPTAEWKETEA
KARAVLLAADLVQGGLDAPHD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcgatgaatttaatgctttagcaaagcaaggctttaatcgaatccctttagta
aaagaagtattggcggatctcgagacgccactatcgctttatgtaaagctaactcaagcc
tttggtaaaaaaaatacttacttactagagtcggttgtaggcggcgaacgctttggtcgc
ttttcattcattggtcttccagcaaaaacgcttttgagaacagctgggacgcccacagcg
ccactgactgagattctgactgatggcaaagttgtagagagtaatcgggataatccactc
gactttatcgatgcctacttcaaacgctttaaagtgcccttacaaaccggcctgccccgc
ttctgtggtggcttagcgggttactttggttacgatactgtgagatatatcgaagcaaaa
ttagctagccacaacttacctgatgaattaggtgtacctgacattcaattgatgctcacc
gaagagttggcggtaattgataacgtcactggaaaaatttatttcattgtctatgctgat
cctgccgagcccaatggctttgaaaaagctcaagtacgcttaaaggaactactcgcatgc
ctaagcaagcccttcagcatgcctgtttcaagaccgagcaataaaacagatttagtgcgt
aactttaaggctgctgattttgagaaagctgttcttaaaactaaagaatatattttggct
ggcgattgtatgcaagtcgtcattggccaacgcattagcaagccctttaccgattctcct
ttagcgctttacagagcattaagatctctcaatccatcgccttatatgtactactatgac
ttcggcgatctccaagtagtcggctcctcaccagaaattttggttaggcaagaactacgt
ggaggagaaaaaatggtgacgattcgccccttggcaggcactcgcccccgcggaagtacg
cctcaagaggatgagcgtctagcaaaagaattgttagctgatcccaaggaaattgctgag
catgtgatgttgatcgatctggctcgtaatgatgtgggtcgcattgccaaaacaggctct
gtccaagtgactgactcgatgtcaattgaaaaatattctcatgtacaacacattgttagc
tctgttgaaggtcaattgctcgacaatatgagcaatatggatgtactacgcgccaccttc
ccagccggtactttatctggtgccccaaagattcgggcgatggaaattattgacgagatg
gaggtcgttaaacgcggcgtctatggtggtgctgtgggctatctctctttctcgggcgat
atggacgttgcaattgcgatacgaactggggtgattcggaatggagttttacattctcaa
gcgggtgctggtgtggttgcagactcagatccaactgcagagtggaaagagaccgaagcc
aaagcgcgtgctgtattgttggctgctgatttagttcaaggaggactcgatgctcctcat
gattga

DBGET integrated database retrieval system