KEGG   Pseudomonas orientalis: BOP93_01770Help
Entry
BOP93_01770       CDS       T05323                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
poi  Pseudomonas orientalis
Pathway
poi00340  Histidine metabolism
poi01100  Metabolic pathways
poi01110  Biosynthesis of secondary metabolites
poi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:poi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BOP93_01770
Enzymes [BR:poi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BOP93_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH GHD
Motif
Other DBs
NCBI-ProteinID: AUZ44347
UniProt: A0A0R3A1U2
LinkDB All DBs
Position
complement(429021..429353)
Genome map
AA seq 110 aa AA seqDB search
MSDTLNRVAQVLEERKGADADSSYVASLYHKGLNKILEKLGEESVETIIAAKDAQISGDC
SDVIYETADLWFHSLVMLAQLGQHPQAVLDELDRRFGLSGHAEKAARPST
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccctcaaccgcgtggcccaggtgctggaagagcgcaagggcgcggatgcc
gacagttcctatgtcgccagcctgtatcacaagggtctgaacaagatcctggaaaaactc
ggcgaagaatccgtcgagacgatcattgccgccaaggatgcgcagatcagcggcgattgc
agcgatgtcatctatgagaccgccgacctgtggttccatagcctggtcatgctcgcccaa
ctggggcagcatccacaggccgtgctggatgaactggaccgtcgcttcggcctgtccggg
cacgccgagaaggctgcacgcccgtccacctga

DBGET integrated database retrieval system