KEGG   Pseudomonas orientalis: BOP93_04535Help
Entry
BOP93_04535       CDS       T05323                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
poi  Pseudomonas orientalis
Pathway
poi00473  D-Alanine metabolism
poi00550  Peptidoglycan biosynthesis
poi01100  Metabolic pathways
poi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:poi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BOP93_04535
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BOP93_04535
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BOP93_04535
Enzymes [BR:poi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BOP93_04535
Peptidoglycan biosynthesis and degradation proteins [BR:poi01011]
 Precursor biosynthesis
  Amino acid ligase
   BOP93_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 ATPgrasp_YheCD TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AUZ44874
UniProt: A0A2L0RT07
LinkDB All DBs
Position
1046096..1047052
Genome map
AA seq 318 aa AA seqDB search
MITDYASLFSTVAPADFGRVAVLFGGKSAEREVSLKSGNAVLQALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVMVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYVASDTQYRIPCGLDAT
KEQHLMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgactacgcctccctgttctccacggtcgcgcctgccgacttcggccgcgtc
gcggtgctgttcggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcaatgcc
gtgctgcaagccctgcaaagcgccggcgtgaatgcgttcggcatcgacgtgggcgatgac
ttcctcgcccgtctgcaggccgaaaagatcgaccgcgccttcatcattctgcatggccgt
ggcggtgaagacggcagcatgcagggcctgctcgaatgcgccggcattccctataccggc
agcggcatcctggcgtcggcgctggcgatggacaagttgcgtaccaagcaggtgtggcac
agcctggggattccaaccccgcgtcacgccgtgctgtgcagcgaagacgattgtatttct
gcggccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggccaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagcacc
tacgattcgcaagtgatggtggaacagtggatccagggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcccatcgcattgggcacgccccacactttctacgattac
gacgccaagtacgtggcttccgatacccagtaccggattccctgcggtcttgacgcaacc
aaggaacaacacttgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggc
tgggcgcgggcagatgtgatgcaggatgaccagggcaatttctggttcctggaagtcaac
accgcaccgggcatgaccgaccacagcctggtccccatggccgcccgtgccgccggcctg
gatttccagcagttggtgctggcgatactggccgccagcatcgagccaagaggctaa

DBGET integrated database retrieval system