KEGG   Pseudomonas orientalis: BOP93_08210Help
Entry
BOP93_08210       CDS       T05323                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
poi  Pseudomonas orientalis
Pathway
poi00220  Arginine biosynthesis
poi00250  Alanine, aspartate and glutamate metabolism
poi00290  Valine, leucine and isoleucine biosynthesis
poi01100  Metabolic pathways
poi01110  Biosynthesis of secondary metabolites
poi01130  Biosynthesis of antibiotics
poi01210  2-Oxocarboxylic acid metabolism
poi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:poi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BOP93_08210
   00290 Valine, leucine and isoleucine biosynthesis
    BOP93_08210
   00220 Arginine biosynthesis
    BOP93_08210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:poi01007]
    BOP93_08210
Enzymes [BR:poi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BOP93_08210
    2.6.1.66  valine---pyruvate transaminase
     BOP93_08210
Amino acid related enzymes [BR:poi01007]
 Aminotransferase (transaminase)
  Class I
   BOP93_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-ProteinID: AUZ45587
UniProt: A0A2L0RTX5
LinkDB All DBs
Position
complement(1870657..1871868)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSLQALLNNGDE
VLVPAPDYPLWTAAVTLAGGHPVHYLCDEGADWFPDLADIKAKITPNTKALVIINPNNPT
GAVYSREVLLGMLELARQHNLVVFSDEIYDKILYDDAVHVCTASLAPDLLCLTFNGLSKS
YRVAGFRSGWIAISGPKHNAQSYIEGIDMLANMRLCANVPSQHAIQTALGGYQSINDLVL
PQGRLLEQRNRTWELLNAIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFVLDLLLSEKL
LVVQGTAFNWPWPDHFRVVTLPRVDELDMAIGRIGNFLKSYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctacgacattcgcggcccggtg
ctcaagcacgccaaacgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccctttggtttcgaagcgcccgacgaaatcctccaggacgtgatccgcaac
ctgcccacggcacagggctacagcgactccaaaggcctgttcagcgcgcgcaaggcggtg
atgcagtattaccagcagaagcaggtggaaggtgtcgggattgaggacatctacctgggc
aatggcgtgtccgagctgatcgtgatgtcgctgcaagccctgctcaacaacggcgacgaa
gtgctggtgccggcgccggactacccattgtggaccgccgccgtgaccctggccggtggc
cacccggtgcattacctctgcgacgaaggtgccgactggttccctgacctggccgatatc
aaggccaagatcaccccgaacacgaaggccctggtgatcatcaacccgaacaaccccacc
ggcgccgtatattccagggaagtgctgctgggcatgctcgaactggcgcgccaacacaac
ctggtggtgttctccgatgagatctacgacaagattctttacgatgacgcagtccacgta
tgcactgcctccctggccccggacctgctgtgcctgaccttcaacggcttgtccaaatcc
taccgcgtggcgggcttccgctccggctggatcgccatttccgggcccaagcacaacgcc
cagagctatatcgaaggcatcgacatgctggccaacatgcgcttgtgcgccaacgtgccg
agccagcacgcgatccagaccgccctcggcggctaccagagcatcaacgatctggtcctg
ccccaaggtcgcctgctggagcaacgtaaccgcacctgggagttgctcaacgcaatcccg
ggcgtcagctgcgtgaagcccatgggggcgttgtatgcattcccgaggattgacccgaaa
gtctgcccgatcctcaacgacgaaaagttcgtgctcgacctgctgctgtcggaaaagctg
ctggtagtgcaaggcaccgcgttcaactggccgtggccggaccacttccgcgtggtgacc
ctaccgcgcgtggatgagctggatatggccatcggtcgcatcggcaacttcctcaagtcc
tatcgccagtaa

DBGET integrated database retrieval system