KEGG   Pseudomonas orientalis: BOP93_12730Help
Entry
BOP93_12730       CDS       T05323                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
poi  Pseudomonas orientalis
Brite
KEGG Orthology (KO) [BR:poi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BOP93_12730
Enzymes [BR:poi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BOP93_12730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AUZ46421
UniProt: A0A2L0RWR8
LinkDB All DBs
Position
complement(2976854..2978419)
Genome map
AA seq 521 aa AA seqDB search
MLDATLKTQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVASLSTLITLHSDGNDAR
KPSFSINRPGAEISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSSAAIYAARKGIRTGVA
AERFGGQVLDTLSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLVPAKSAGE
LHEIHFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDNKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLVYKDRDSGEFKTLDLEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccactcttaaaactcagttgaagtcatacctggagcgggttacccagccg
atcgagatcgtcgcctccctcgatgacggcgcgaaatcccaggaaatgctcgctcttttg
caggacgtagccagcctctccacgctgattaccctgcacagcgatggcaatgatgcgcgc
aagccgtcgttctccatcaaccgcccgggtgccgagatcagcctgcgtttcgccggcatc
cccatgggccatgaattcacgtccctggtgctggccctgctgcaagtcggtggccaccca
tccaaggccagtgtcgaagtgattgaacagatccgtgccttgaaaggcgagttcagcttc
gagacttacttttcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaaccccaacatccgccacgtagccatcgacggcgcgctgttccaggct
gaagtcgatgagcgccagatcatggcggtgcccagtgtctaccttaacggtgtgaacttc
ggccagggccgcatgggcctggaggaaatcctcgccaagctcgacaccagcggtatcgaa
aaggccgccgagaaaatcagcgccaaggatgcctttgatgtattggtcgtcggcggtggt
ccggccggttcatcggctgcgatctacgcggcgcgtaaaggcattcgcaccggtgtggcc
gccgagcgctttggtggccaggtgcttgacaccctgtccatcgagaactttatctcggtc
caggaaaccgaaggcccgaaactggccagtgccctggaagcccatgtacgtcagtacgac
gtcgacatcatgaacctgcagcgtgccagcagcctggtgccggcgaaaagcgccggcgag
ctgcacgaaatccacttcgaaagcggtgcgacgctcaagtccaagaccgtgatcctggcc
accggtgcacgctggcgtgaaatgggcgtgccgggcgagcaggaatacaaggccaagggc
gtgtgcttttgcccgcattgcgatggtccgttgttcaagggcaagcgcgtggcggtgatt
ggtggcggtaactccggcgtcgaagctgccatcgacctggccggtatcgtcagccatgtc
accttgctggagttcgacaacaaactgcgcgccgacgctgtgttgcagcgcaagctgtac
agcctgccgaacgttgatgtgatcaccagcgccttgaccagtgaagtcaaaggcgatggt
cagaaagtcaccggccttgtctacaaggatcgcgacagcggcgagttcaagaccctcgac
ctggaaggcatctttgtgcaaatcggtctgttgcccaacaccgactggctcaaaggcact
gtagaactgacgcctcgcggcgagatcatcgtcgatgcgcgtggcgagacctcattgccg
ggtgtattcgccgccggtgacgtgacgactgtgccgtacaagcagatcgtgattgccgtg
ggcgagggcgccaaggcttccctgagcgcgttcgaccacctgatccgcacgtccgcccct
gcgtaa

DBGET integrated database retrieval system