KEGG   Pseudomonas orientalis: BOP93_13240Help
Entry
BOP93_13240       CDS       T05323                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
poi  Pseudomonas orientalis
Pathway
poi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:poi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BOP93_13240 (ligD)
Enzymes [BR:poi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BOP93_13240 (ligD)
DNA repair and recombination proteins [BR:poi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BOP93_13240 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AUZ46515
UniProt: A0A2L0RWN1
LinkDB All DBs
Position
3076959..3079484
Genome map
AA seq 841 aa AA seqDB search
MAKPLSEYNRKRDFGITAEPAGKPSAGKRKACALSFVIQKHAARNLHYDFRLELDGVLLS
WAVPKGPSLDPSQKRLAVHVEDHPLSYGGFEGSIPAGQYGAGDVIVWDRGIWQPHDDPHK
AYAAGKLKFSLVGEKLTGDWTLVRTRLKGSGDKQQWLLIKEKDQQARPSAEYDIVEAQPA
SVLSDAVVGKSKTKPEAKAATKTTPKASARKQAAAVPEAFSPQLATLVDRAPEGDWHYEI
KFDGYRILARIRGGEVRLFTRNGHDWTERLPRQVKALQALKLKDSWLDGEVVSLNGDGLP
DFQALQNAFDIGRSLDIIYYLFDAPFLDGRDQREEPVEARRAALKSALSASKSKLLRFSE
AFAANHRDIFESACDLALEGVIGKRAGSPYVSSRSADWIKLKCRLRQEFVIVGYTRPQGS
RTGFGALLLAVNDDTALVYAGRVGTGFDQASLKSIYAKLTALERTDSPLQKPLTSAQARG
VHWVEPSLVGEVQFAEWTREGVVRQAAFVGMRTDKPAAQIIREQPRTAKSVKAPKAKKTE
KEVKPVKAMKITHPERVIDQQSGTQKQELAQFYADISESILPFLRNRPVSLLRAPEGIEG
EQFFQKHSERMTIPHIKQLDKALDPGHARLMEIDSADALIGAVQMGTVELHTWGATTDKI
ETPDLFILDLDPDPALPWKSMLEAAQLTLSVLDEIGLQAFVKTSGGKGLHLIVPLARRDN
WDTVKAFAKAIAQFMTQQLPERFTATSGPKNRVGKIFIDYLRNARGASTVAAYSVRARPG
LPVSVPISRDELSDLRGAQQWTVANLHERLRDLKDDPWAGYANRQKISKQMWDKLGAKPP
K
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcccctgagcgagtacaaccgcaaacgcgacttcgggattaccgccgagccg
gcaggcaagccatcggccggcaagcgcaaagcttgcgccctgagctttgtgatccagaaa
catgctgcgcgcaacctgcactatgattttcgcctggaactggacggcgtgctgttgagc
tgggccgtgcccaaaggcccgagcctggacccgagccagaaacgcctggcggtccacgtc
gaagaccatcccctgagttatggcggcttcgaaggcagcattcccgccgggcaatatggc
gccggggatgtgatcgtctgggaccgtggcatctggcaaccccatgacgacccgcacaag
gcctacgcggctggcaaactgaaattcagcctggtcggcgaaaaactcaccggcgactgg
accttggtgcgcacccggctcaaaggcagcggcgacaagcaacaatggttgctgatcaag
gaaaaggaccagcaggcgcgtccttcggctgagtacgatatcgtcgaggcacagcccgcc
agcgtgctcagcgatgctgtggtcggcaaatccaagaccaagcctgaggccaaggcagca
accaaaacgacacccaaggcgagcgcgcgaaagcaggcagccgccgtgcccgaagcgttc
tccccgcaactggcaacgttggttgatcgggcgcccgagggtgactggcactacgagatc
aagttcgacggttaccgcatcctcgcgcgcatccgcggcggcgaggtacgcctgttcact
cgtaatggccacgattggaccgagcgcctgccgcgccaggtcaaagccttgcaagcgctc
aagcttaaggacagctggcttgatggcgaagtggtcagccttaacggcgatgggttgccg
gatttccaggcattgcaaaatgccttcgacattggccgcagcctcgacatcatttactac
ctgttcgatgcgccgtttcttgacggccgtgatcagcgcgaagagcccgtcgaagcgcgt
cgcgcggcacttaaatctgcgctgtccgccagcaagagcaagctgctgcgcttctccgaa
gcctttgccgccaaccaccgcgacattttcgaaagcgcctgtgacctggccttggagggt
gtcatcggcaagcgtgccggcagcccttacgtgtccagccgcagtgctgactggatcaag
ctcaaatgccgcctgcgccaggagttcgtgattgtcggttacacgcggccccaaggctcg
cgcaccgggtttggcgcgctgctgctggcagtcaacgacgataccgcactggtgtatgcc
gggcgggtgggcaccggtttcgaccaggcgtcgctcaaatccatctatgccaagcttacc
gcgctcgaacgcacggactcgccgctgcaaaagccgttgaccagcgcccaggcgcgcggc
gtgcactgggttgagccgagcctggtcggtgaagtgcaatttgccgagtggactcgcgaa
ggcgtggtgcgccaggctgcctttgtgggcatgcgcaccgacaagcccgctgcgcagatc
atccgtgagcagccgcgtacggccaaatcggtgaaggcgccaaaggcgaaaaaaaccgag
aaggaggtgaaacccgtgaaggccatgaaaatcacccaccctgagcgggtcatcgaccag
cagagcggcacgcaaaagcaggaactggcacagttctacgccgatatcagcgaatcgatc
ctgcccttcctgcgcaaccggcccgtctcactgctcagggcgccggaaggcatcgaaggc
gaacagttcttccagaagcattccgagcgcatgaccatcccgcacatcaagcagttggac
aaggcactggaccccggccatgcccgcctgatggaaatagacagcgccgatgccctgatc
ggcgcggtgcaaatgggcacggttgagctgcacacctggggcgctaccacggataagatc
gaaacccccgacctgttcatactcgacctcgacccggaccccgccctgccctggaaatcc
atgctggaagcggcgcagttgacgctgtcggtactggatgaaataggtttgcaggccttc
gtcaaaaccagcggtggcaaaggcttgcacctgatcgtaccgctggcgcggcgcgataac
tgggacaccgtcaaagccttcgccaaggccatcgcccaattcatgacccagcaactgccg
gagcgctttaccgccaccagcggcccgaagaaccgcgtgggcaaaatcttcatcgattat
ctgcgcaacgcccggggcgccagcactgtggcggcttactccgtgcgggcgcgaccaggc
ctgccggtgtcggtaccgatcagtcgcgatgaattgagtgacttgcgcggtgcccagcaa
tggacggtggccaacctgcacgagcgattgcgcgacttgaaagacgacccttgggccggc
tatgccaatcggcagaagatcagcaagcagatgtgggacaagctgggcgcgaagccaccg
aagtga

DBGET integrated database retrieval system