KEGG   Polaromonas sp. JS666: Bpro_0093Help
Entry
Bpro_0093         CDS       T00343                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00630  Glyoxylate and dicarboxylate metabolism
pol01100  Metabolic pathways
pol01120  Microbial metabolism in diverse environments
pol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bpro_0093
Enzymes [BR:pol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Bpro_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABE42060
UniProt: Q12HD2
LinkDB All DBs
Position
97094..98335
Genome map
AA seq 413 aa AA seqDB search
MSERIHATYWLETGDDPRRAAEVIAGEQSSGTFITLPNETPALKARSGARIERLEVLEQV
GQPSLPVATPAKVYTRCTLELSWPIENLGPSLPNLMSTIAGNLFELRQVSGLRVLDLKLP
ASFAAAYPGPAFGIAGTRRLSGVAQGPLIGTIIKPSVGLDPAQTAEQVRQLIDGGIDFIK
DDELQADGPHCPFDERVRAVMQVVNDAAQRDGRKVMVAFNLTGDLDQMRRRHDLVQSLGG
TCVMASLNSIGLVGLLELRRHASLPIHAHRCGWGYLSRSPALGWDFAPWHQIWRLAGADH
LHVNGLANKFSESDASVIAAARAVLRPLFAHQPMPAMPVFSSGQTGLQAPGTYAALGSAD
LIHAAGGGIFGHPGGIASGVSAFRQAWEAAMAGTPLHEHAKTHAELRSALEFW
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacgtattcacgcgacctactggctggaaaccggcgatgacccgcggcgcgcc
gccgaggtgattgccggcgagcagtccagcggcaccttcatcacgctgcccaacgagaca
ccggcgctgaaggcgcgctccggagcgcgcatcgaacggctggaggtgctggagcaggtc
ggccagcccagcctgccggtcgccacgccggccaaggtctacacccgctgcacgctggag
ctgtcgtggccgatcgagaacctcggcccctcgttgcccaacctgatgtcgaccatcgcc
ggcaacctgttcgagctgcgccaggtgtcgggcctgcgtgtgctggacctgaaactgcca
gcgtcgttcgccgctgcctaccccggcccggccttcggcatagccggcacgcggcgcctg
tccggcgtggcgcagggcccgctgatcggcaccatcatcaagcccagcgtcgggctggac
ccggcgcagacggccgagcaggtgcgccagctgattgacggcggcatcgacttcatcaag
gacgatgagctgcaggccgacgggccgcattgcccgttcgacgagcgtgtgcgcgccgtg
atgcaggtggtcaacgacgcggcccagcgcgacgggcgcaaggtcatggtggccttcaac
ctgaccggcgacctggaccagatgcggcggcgccacgacctcgtgcagtcgctgggcggc
acctgcgtgatggccagcctcaattccataggcctggtcggcctgctcgagctgcgccgc
catgccagcctgcccatccatgcccaccgctgcggctggggttatctctcgcgcagcccg
gcgctgggctgggactttgcgccatggcaccagatctggcgcctggcgggtgccgaccac
ctgcatgtcaatggcctggccaacaagttcagcgaatccgacgcgagcgtgatcgccgcc
gcgcgcgcggtgctgaggccgctgttcgcccaccagccgatgccggccatgccggtcttc
agttcgggccagaccggcctgcaggcgcccggcacctatgcggcgctcggcagcgcggac
ctgatccatgccgctggcggcggcatctttggccacccgggtggcattgcctccggggtc
agcgccttccgccaggcctgggaggcggcgatggctggcacgccgctgcacgagcatgcc
aaaacgcatgccgagctgcgcagcgcgcttgagttctggtga

DBGET integrated database retrieval system