KEGG   Polaromonas sp. JS666: Bpro_0484Help
Entry
Bpro_0484         CDS       T00343                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00564  Glycerophospholipid metabolism
pol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bpro_0484
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Bpro_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 NAD_binding_8 HI0933_like Pyr_redox_3 Lycopene_cycl 3HCDH_N Pyr_redox GIDA Thi4
Motif
Other DBs
NCBI-ProteinID: ABE42448
UniProt: Q12G94
LinkDB All DBs
Position
501130..502731
Genome map
AA seq 533 aa AA seqDB search
MQPMTTESLPAPAPTRRHDLIARLAQPCQYDLAIIGGGATGLGVALDAAARGFSVVLVES
HDFAKGTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLANAPHLAQPLAFVMPSYKF
WEAPFYGVGLKMYDALAGKAGLGPTEFLSRTETLDCLPTAQPQGLKGGVKYWDGQFDDAR
LALALARTAARQGALLVNYCAATGLIHENGKLVGLHAQDQETGRLFEIKAKCVVNAAGVW
VDQLRLQDGQAIGRETQPMVAPSQGVHIVVDRSFLPTDHAMLIPKTADGRVLFAVPWLGK
TILGTTDTPRHDLAREPLPFKEEVDFILRESARYLSRAPGPTDIKSIWVGLRPLVKPSDD
HAERTQALSREHTVLVSNSGLVTVTGGKWTTYRAMAEDVMETCFAAGLLPRRAGTATAHL
KLVGAQDLGRKISDAPGVHLYGSEAAVVQGLPGAAHELGGGLTEAMVRFAARYEYARCVE
DVLARRSRLLFLDAALARSLASEVAVLLQQENGVDPQLEAFLALCGQYLSLPD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccatgacgactgaatccttgccggcaccggcaccaacgcggcgccatgacctg
atcgcccggctggctcagccctgtcagtatgacctcgccatcatcggcggcggcgccacc
ggcctgggcgtggcgcttgatgccgcggcgcgcgggttttctgtcgtgctggtcgaatcg
cacgactttgccaaaggcacctcgtcgcgggctaccaagctggtgcatggtggtgtgcgc
tatctggcgcaaggcaatatttcattggtgcgcgaggccttgcacgagcgcaccacgctg
ctggccaatgcgccgcacctggcgcagcccctggcttttgtcatgccttcttataagttc
tgggaggcgcctttttatggtgtgggcctgaagatgtacgacgccctggccggcaaggcc
gggctgggtcccaccgagttcctgagccggaccgaaaccctggactgcctgccgacggcg
cagccgcagggcctcaagggcggcgtcaagtactgggacggccagtttgacgatgcgcgc
ctggccctggcgctggcccgcaccgccgcccgccagggcgcgttgctggtcaactactgt
gccgccacgggcttgattcatgaaaacggcaaactggtgggccttcacgcgcaggaccag
gaaacaggccgcctctttgagatcaaggccaaatgtgtggtgaatgcggcgggtgtctgg
gtagaccagctgcgccttcaggacgggcaggccataggtcgcgaaacccagcccatggtc
gcccccagccagggcgtgcatattgtggtggaccggtcgtttttgcccaccgaccacgcc
atgctgattcctaaaacggctgacggccgggtgttgtttgccgtgccctggctgggtaaa
accattctggggaccaccgatacgccgcgtcatgatctggcccgcgagccgctgccgttc
aaggaagaggttgatttcatcctgcgcgaatcggcgcgctacctgagccgcgcgcctggc
ccgaccgacatcaaaagcatctgggtcggcctgcgccccctggtcaagccgtctgatgac
catgcggagagaacccaggccctgtcgcgtgagcatacggtgctggtcagcaacagcggc
ctggtcacggtgacaggggggaagtggaccacttaccgggccatggcggaggatgtgatg
gagacatgcttcgccgcgggcttgctcccgaggcgtgcaggtaccgcgaccgcccacctc
aagttagtgggtgctcaggacctgggccgtaaaatcagtgacgcaccgggtgttcaccta
tacgggagtgaggccgcggttgtgcagggcctgccgggcgccgcccatgaactcgggggg
gggctgacggaggccatggtgcggtttgcggcccgctacgagtacgcgcgttgcgtggaa
gacgtgctggctcgccgctcccgcctgttgttcctggacgcggccctggcccggtcgctg
gcgtcagaagtggccgtattgcttcagcaggaaaacggggtggacccgcaactggaggca
tttttggcgctttgcggccagtacctcagcttgcccgactga

DBGET integrated database retrieval system